[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55134.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->47 PF00375 * SDF 4.3e-06 30.8 39/390  
:BLT:SWISS 5->43 SSTT_STRA5 5e-11 69.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55134.1 GT:GENE ACF55134.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1604707..1604865 GB:FROM 1604707 GB:TO 1604865 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACF55134.1 GB:DB_XREF GI:194356686 LENGTH 52 SQ:AASEQ MWGILGLTLPNLSGIGLLGDLFVGGLKAVAPILVFALVANALSNIKRDKIAI GT:EXON 1|1-52:0| BL:SWS:NREP 1 BL:SWS:REP 5->43|SSTT_STRA5|5e-11|69.2|39/402| TM:NTM 2 TM:REGION 3->25| TM:REGION 28->47| HM:PFM:NREP 1 HM:PFM:REP 9->47|PF00375|4.3e-06|30.8|39/390|SDF| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----1------1--1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 47-47,49-53| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //