[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55138.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:250 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55138.1 GT:GENE ACF55138.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 627273..628025 GB:FROM 627273 GB:TO 628025 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55138.1 GB:DB_XREF GI:194356690 LENGTH 250 SQ:AASEQ MKQFVQFYKKDFLAVLVYFILLLSCVLSSTVYLLRCRQYSIHPNVLEWILVLLQDMTTGVYCFPFTYILFFFYLMNNYFNRLECRIRLKSIKHFTSFSFKLAALSTGIWTAILFLLIFLIAFSNGFSFSLEIKEVDFLREFYGISIANNASFFIGFFFSYIAYYFFLSLLTISSFSWFKKSNMSLVFLFTFLFVESLFWIYQLNNGIIGLLPIFQYMVNSNPYALIYWLTLLSIIIPLTVFSVHRNWRRV GT:EXON 1|1-250:0| TM:NTM 6 TM:REGION 11->33| TM:REGION 49->71| TM:REGION 100->122| TM:REGION 152->174| TM:REGION 181->203| TM:REGION 214->236| SEG 67->82|yilfffylmnnyfnrl| SEG 111->122|ailfllifliaf| SEG 165->178|fflslltissfswf| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,250-251| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHcEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccc //