[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55143.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.298.1
:84 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->82 3g5oC PDBj 1e-04 32.5 %
:RPS:PDB   7->84 3bpqB PDBj 3e-09 23.7 %
:RPS:SCOP  2->81 1wmiA1  d.298.1.2 * 4e-14 21.2 %
:HMM:SCOP  1->83 1wmiA1 d.298.1.2 * 2.7e-21 43.9 %
:RPS:PFM   53->81 PF05016 * Plasmid_stabil 6e-04 64.3 %
:HMM:PFM   7->84 PF05016 * Plasmid_stabil 8.8e-15 38.4 73/88  
:BLT:SWISS 9->80 RELE_SHIFL 3e-04 31.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55143.1 GT:GENE ACF55143.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1092961..1093215) GB:FROM 1092961 GB:TO 1093215 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55143.1 GB:DB_XREF GI:194356695 LENGTH 84 SQ:AASEQ MYKLVPTRRFIKQLKKLDRYTQKLITNYLQTNVLEDPRRHGKALVGNRVXQWRYRIGNYRVIVQIVDDELVVATLEVGHRRDIY GT:EXON 1|1-84:0| BL:SWS:NREP 1 BL:SWS:REP 9->80|RELE_SHIFL|3e-04|31.0|71/95| BL:PDB:NREP 1 BL:PDB:REP 3->82|3g5oC|1e-04|32.5|80/87| RP:PDB:NREP 1 RP:PDB:REP 7->84|3bpqB|3e-09|23.7|76/85| RP:PFM:NREP 1 RP:PFM:REP 53->81|PF05016|6e-04|64.3|28/90|Plasmid_stabil| HM:PFM:NREP 1 HM:PFM:REP 7->84|PF05016|8.8e-15|38.4|73/88|Plasmid_stabil| RP:SCP:NREP 1 RP:SCP:REP 2->81|1wmiA1|4e-14|21.2|80/88|d.298.1.2| HM:SCP:REP 1->83|1wmiA1|2.7e-21|43.9|82/0|d.298.1.2|1/1|RelE-like| OP:NHOMO 75 OP:NHOMOORG 58 OP:PATTERN --------------------------------------------------11---------------- -----------------------------------------------1---------1----------------------1-----------------------------------------------11-----1--------------------------------1------------------1-----------------------------------1-----------------------------1----------------------------1111--111111112122------11------23---333----------------------------1--------------------33--------11-1-----------------------------------1--11---------------------------------------1------------------1------------------------------------------------------------------------------------------1---------------1----------------------------------------1----------1-----------------------1------1------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------111---1--------------2---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 97.6 SQ:SECSTR ##EEEEcHHHHHHHTTccHHHHHHHHHHHHHHHccccccccEEEcTTcccEEEEEETTEEEEEEEETTEEEEEEEEEEEHHHHG DISOP:02AL 82-85| PSIPRED cEEEEEcHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEccEEEEEEEEccEEEEEEEEEEcccccc //