[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55147.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->97 PF03568 * Peptidase_C50 4e-04 29.5 %
:HMM:PFM   59->146 PF10974 * DUF2804 0.00012 26.5 83/331  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55147.1 GT:GENE ACF55147.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1752271..1752729) GB:FROM 1752271 GB:TO 1752729 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55147.1 GB:DB_XREF GI:194356699 LENGTH 152 SQ:AASEQ MTPEEMYLTERLDVQIAHFLKKSVQHRRRYKVLKITEIVAGFLIAVFCAIPMPGDRYRLISVALSSLGLLCEGIINLYNAKENWISYQKTAQLLEKEKFLYQCQTEKYAGKTKAFALFVKTCEGLISEEINQWESIQSKEVAASADAPVKKE GT:EXON 1|1-152:0| TM:NTM 2 TM:REGION 31->51| TM:REGION 58->79| RP:PFM:NREP 1 RP:PFM:REP 3->97|PF03568|4e-04|29.5|95/384|Peptidase_C50| HM:PFM:NREP 1 HM:PFM:REP 59->146|PF10974|0.00012|26.5|83/331|DUF2804| GO:PFM:NREP 3 GO:PFM GO:0005634|"GO:nucleus"|PF03568|IPR005314| GO:PFM GO:0006508|"GO:proteolysis"|PF03568|IPR005314| GO:PFM GO:0008233|"GO:peptidase activity"|PF03568|IPR005314| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------1------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------12111-11111------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-4,143-143,145-148,150-153| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //