[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55151.1
DDBJ      :             Tn5251 hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:305 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   80->123 PF05565 * Sipho_Gp157 0.00014 25.0 44/162  
:HMM:PFM   3->46 PF11169 * DUF2956 0.0009 34.1 44/103  
:BLT:SWISS 4->150 YDDB_BACSU 4e-05 23.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55151.1 GT:GENE ACF55151.1 GT:PRODUCT Tn5251 hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1194713..1195630) GB:FROM 1194713 GB:TO 1195630 GB:DIRECTION - GB:PRODUCT Tn5251 hypothetical protein GB:NOTE identified by similarity to RF:YP_133682.1 GB:PROTEIN_ID ACF55151.1 GB:DB_XREF GI:194356703 LENGTH 305 SQ:AASEQ MMKFRKNQNKEKQIPKEKKPRVYYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTIHETTIIEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQIWTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIESEGTVDSITTNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTVEYIDQQTKATQVSQFDLVLEKNGSNWKIIE GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 4->150|YDDB_BACSU|4e-05|23.1|143/100| SEG 55->67|idthtihettiie| HM:PFM:NREP 2 HM:PFM:REP 80->123|PF05565|0.00014|25.0|44/162|Sipho_Gp157| HM:PFM:REP 3->46|PF11169|0.0009|34.1|44/103|DUF2956| OP:NHOMO 24 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1-----1----------1-------2-------------------------1------------111-11-1--------------11---2-1----------1------5----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-25,97-98,198-208,210-210| PSIPRED cccHHHHHHHHHccccccccEEEEEcccccEEEEHHHHHHHHHHHHHHHHHHHEEccccccccEEEEEEEEEcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEccccccEEEEEEEEEEEEEcccccEEEEcccEEccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccEEEEEEEcccEEEEcccEEEEEEEEEEccccccccEEEEEEEEEEEccccEEEEc //