[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55152.1
DDBJ      :             choline kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   176->275 3dxqB PDBj 2e-09 30.2 %
:RPS:PDB   26->278 3dxqB PDBj 5e-21 22.0 %
:RPS:SCOP  26->283 1zylA1  d.144.1.6 * 5e-08 9.9 %
:HMM:SCOP  1->281 1nw1A_ d.144.1.8 * 4.7e-46 28.5 %
:RPS:PFM   39->208 PF01633 * Choline_kinase 1e-09 31.0 %
:HMM:PFM   39->236 PF01633 * Choline_kinase 1.5e-38 29.4 194/211  
:HMM:PFM   6->59 PF09265 * Cytokin-bind 0.00033 24.1 54/281  
:BLT:SWISS 26->278 LICA2_HAEIN 3e-35 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55152.1 GT:GENE ACF55152.1 GT:PRODUCT choline kinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1136494..1137363) GB:FROM 1136494 GB:TO 1137363 GB:DIRECTION - GB:PRODUCT choline kinase GB:NOTE identified by match to protein family HMM PF01633; match to protein family HMM PF01636 GB:PROTEIN_ID ACF55152.1 GB:DB_XREF GI:194356704 LENGTH 289 SQ:AASEQ MEKIIKEKISSLLSQEEEVLSVEQLGGMTNQNYLAKTTNKQYIVKFFGKGTEKLINRQDEKYNLELLKDLGLDVKNYLFDIEAGIKVNEYIESAITLDSTSIKTKFDKIAPILQTIHTSAKELRGEFAPFEEIKKYESLIEEQIPYANYESVRNVVFSLEKRLADLGVDRKSCHIDLVPENFIESPQGRLYLIDWEYSSMNDPMWDLAALFLESEFTSQEEETFLSHYESDQTPVSHEKIAIYKILQDTIWSLWTVYKEEQGEDFGDYGVNRYQRAIKGLASYGGSDEK GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 26->278|LICA2_HAEIN|3e-35|31.0|252/339| SEG 10->25|ssllsqeeevlsveql| SEG 210->226|lfleseftsqeeetfls| BL:PDB:NREP 1 BL:PDB:REP 176->275|3dxqB|2e-09|30.2|96/280| RP:PDB:NREP 1 RP:PDB:REP 26->278|3dxqB|5e-21|22.0|236/280| RP:PFM:NREP 1 RP:PFM:REP 39->208|PF01633|1e-09|31.0|168/202|Choline_kinase| HM:PFM:NREP 2 HM:PFM:REP 39->236|PF01633|1.5e-38|29.4|194/211|Choline_kinase| HM:PFM:REP 6->59|PF09265|0.00033|24.1|54/281|Cytokin-bind| RP:SCP:NREP 1 RP:SCP:REP 26->283|1zylA1|5e-08|9.9|252/325|d.144.1.6| HM:SCP:REP 1->281|1nw1A_|4.7e-46|28.5|277/395|d.144.1.8|1/1|Protein kinase-like (PK-like)| OP:NHOMO 65 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------122-------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------11111111111------------------------11-1-------1-1----1111------21-----1-----------2-----------------1--------------------11-11-1--1--1--1---1------------1-11------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1111---------1--1112-11-----------------------------------------------------------------------2--------------111----------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 87.5 SQ:SECSTR #########################cccccEEEEETTcccEEEEEEccHHHHHHHHHHHHHTHHHHHHHTTccccEEEEcTTTcccEEEccTTcEEcHHHHHTTHHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHTTccccTTHHHHHHHHHHHHHHHHTcccccEEEcccccGGGEEEcEccccEEcccTTccEEcHHHHHHHHHHHTTccHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHH########### DISOP:02AL 285-290| PSIPRED cHHHHHHHHHHccccccccEEEEEcccccccEEEEEEcccEEEEEEcccccHHHHcHHHHHHHHHHHHHccccccEEEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEccccccccEEEccccEEEEEEccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccc //