[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55156.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->47 PF03021 * CM2 0.00069 48.7 39/139  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55156.1 GT:GENE ACF55156.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1168054..1168224) GB:FROM 1168054 GB:TO 1168224 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55156.1 GB:DB_XREF GI:194356708 LENGTH 56 SQ:AASEQ MKKENEYVILTTASLGVMIGIVFAIFLDFPVEYGISLGLLNGIVLGSLIVYKNNKN GT:EXON 1|1-56:0| TM:NTM 2 TM:REGION 8->30| TM:REGION 34->56| HM:PFM:NREP 1 HM:PFM:REP 3->47|PF03021|0.00069|48.7|39/139|CM2| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111-21--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,54-57| PSIPRED ccccccEEEEEEHHHHHHHHHHHHHHHccHHHHcHHHHHHHHHHHEEEEEEEcccc //