[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55160.1
DDBJ      :             endoribonuclease L-PSP, putative
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  669/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
d.79.1
:126 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->123 2dyyD PDBj 6e-35 56.1 %
:RPS:PDB   1->123 2b33A PDBj 1e-42 53.7 %
:RPS:SCOP  3->123 1jd1A  d.79.1.1 * 3e-38 40.8 %
:HMM:SCOP  2->126 1qd9A_ d.79.1.1 * 7.6e-46 50.0 %
:RPS:PFM   11->125 PF01042 * Ribonuc_L-PSP 2e-25 53.0 %
:HMM:PFM   7->124 PF01042 * Ribonuc_L-PSP 9.2e-48 57.6 118/121  
:BLT:SWISS 3->125 ALDR_LACLA 2e-41 65.0 %
:PROS 101->119|PS01094|UPF0076

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55160.1 GT:GENE ACF55160.1 GT:PRODUCT endoribonuclease L-PSP, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1440611..1440991) GB:FROM 1440611 GB:TO 1440991 GB:DIRECTION - GB:PRODUCT endoribonuclease L-PSP, putative GB:NOTE identified by match to protein family HMM PF01042; match to protein family HMM TIGR00004 GB:PROTEIN_ID ACF55160.1 GB:DB_XREF GI:194356712 LENGTH 126 SQ:AASEQ MAKTIHTDKAPKAIGPYVQGKIVGNLLFASGQVPLSPETGEIVGENIQEQTEQVLKNIGAILAEAGTDFDHVVKTTCFLSDMNDFVPFNEVYQTAFKEEFPARSAVEVARLPRDVKVEIEVIAEIG GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 3->125|ALDR_LACLA|2e-41|65.0|123/126| PROS 101->119|PS01094|UPF0076|PDOC00838| BL:PDB:NREP 1 BL:PDB:REP 1->123|2dyyD|6e-35|56.1|123/126| RP:PDB:NREP 1 RP:PDB:REP 1->123|2b33A|1e-42|53.7|123/127| RP:PFM:NREP 1 RP:PFM:REP 11->125|PF01042|2e-25|53.0|115/119|Ribonuc_L-PSP| HM:PFM:NREP 1 HM:PFM:REP 7->124|PF01042|9.2e-48|57.6|118/121|Ribonuc_L-PSP| RP:SCP:NREP 1 RP:SCP:REP 3->123|1jd1A|3e-38|40.8|120/126|d.79.1.1| HM:SCP:REP 2->126|1qd9A_|7.6e-46|50.0|124/0|d.79.1.1|1/1|YjgF-like| OP:NHOMO 1423 OP:NHOMOORG 879 OP:PATTERN 11---111111111111111111-41121121--------------11------1111-11---1--- 142-----221---1---------11-----11----221----111-----2----1----1-111141-11111112-12-1111111111111---11111131312--------------1---------1-11122111111-1111111111111111111111111111111111131111111111111111111111111113321111111111-1111112111111111111111-111113----------------1---1-111---1---11111111111111111111111111111111111111111222222122221222111111111-11--53-5--1-1111111115--211--------422--------11111111113-11-1121323--3331115212142-11--1-----11------------------------------------------------11-1522131112113111121322111114153312--224--1--2-4131-21111122111111111111111114-13113331-211111111111121111121111111111111111111111113212111123312222116333213412231-2111111-11122111223333333333-2333433333233333333435111121112111111121221322233322-23332333322211-21111111111112211121111111111122222221331222224433145432554111111111123351111132322211111111111111111--------------1----------1--------2--------111111111-2- ----221----11112233423334222222223332323333111434564J8334222221231321112-112222221111-11-36223224741111212-122511222111-111111121121-11211111111111-1-1111-111-2--231111263131111117111111112211------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 100.0 SQ:SECSTR ccEEEccTTccccccccccEEEETTEEEEEEEccccTTTcccccccHHHHHHHHHHHHHHHHHHTTccGGGEEEEEEEEccGGGHHHHHHHHHHHHTTTccEEEEEEccccGGGccEEEEEEEEcc PSIPRED ccEEEccccccccccccccEEEEccEEEEEcEEEEEccccEEccccHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEccHHHHHHHHHHHHHHcccccccEEEEEHHHcccccEEEEEEEEEEc //