[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55161.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:43 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->35 PF11502 * BCL9 0.00034 27.8 18/40  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55161.1 GT:GENE ACF55161.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(809231..809362) GB:FROM 809231 GB:TO 809362 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55161.1 GB:DB_XREF GI:194356713 LENGTH 43 SQ:AASEQ MAVKFTKRDDLDKMFEEFAKLPDLKQVTFPDDKEKKAKAEKKN GT:EXON 1|1-43:0| SEG 31->42|ddkekkakaekk| HM:PFM:NREP 1 HM:PFM:REP 18->35|PF11502|0.00034|27.8|18/40|BCL9| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,32-44| PSIPRED cccEEccHHHHHHHHHHHHcccccccccccccHHHHHHHHHcc //