[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55165.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:94 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->94 3bddA PDBj 3e-20 47.3 %
:RPS:PDB   5->85 3e6mC PDBj 6e-05 16.9 %
:RPS:SCOP  5->86 2bv6A1  a.4.5.28 * 7e-08 29.1 %
:HMM:SCOP  5->88 1jgsA_ a.4.5.28 * 6.7e-11 38.6 %
:RPS:PFM   5->37 PF01047 * MarR 4e-04 48.5 %
:HMM:PFM   4->39 PF01047 * MarR 1.2e-11 38.9 36/59  
:BLT:SWISS 3->93 YDGJ_BACSU 1e-08 34.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55165.1 GT:GENE ACF55165.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1872832..1873116) GB:FROM 1872832 GB:TO 1873116 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID ACF55165.1 GB:DB_XREF GI:194356717 LENGTH 94 SQ:AASEQ MAVQERLKIDQAALTRHFKILETEGLVERHRNPENQREVLVEAAKYAKEQLVVNPPLQHIKVKEEMESILTEFERTELSRLLNKLVLGIENIEI GT:EXON 1|1-94:0| BL:SWS:NREP 1 BL:SWS:REP 3->93|YDGJ_BACSU|1e-08|34.4|90/164| BL:PDB:NREP 1 BL:PDB:REP 1->94|3bddA|3e-20|47.3|93/138| RP:PDB:NREP 1 RP:PDB:REP 5->85|3e6mC|6e-05|16.9|77/145| RP:PFM:NREP 1 RP:PFM:REP 5->37|PF01047|4e-04|48.5|33/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 4->39|PF01047|1.2e-11|38.9|36/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 5->86|2bv6A1|7e-08|29.1|79/136|a.4.5.28| HM:SCP:REP 5->88|1jgsA_|6.7e-11|38.6|83/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------1----------------------1------------11-11-1111---------------11---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 100.0 SQ:SECSTR HHHHHHHTTcHHHHHHHHHHHHHTTcEEEEEEccEEEEEEcHHHHHHHHHHHEEEEHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHTccc DISOP:02AL 1-1,94-95| PSIPRED ccHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccc //