[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55177.1
DDBJ      :             choline-binding protein F, point mutation
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.109.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->141 2vyuA PDBj 9e-28 52.7 %
:RPS:SCOP  32->111 2bibA1  b.109.1.1 * 6e-07 24.1 %
:HMM:SCOP  10->111 2bibA1 b.109.1.1 * 1.3e-08 35.4 %
:BLT:SWISS 16->133 TOXA_CLODI 2e-08 34.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55177.1 GT:GENE ACF55177.1 GT:PRODUCT choline-binding protein F, point mutation GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 349551..349976 GB:FROM 349551 GB:TO 349976 GB:DIRECTION + GB:PRODUCT choline-binding protein F, point mutation GB:PROTEIN_ID ACF55177.1 GB:DB_XREF GI:194356729 LENGTH 141 SQ:AASEQ MKLLKKMMQVALATFFFGLLGTSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPRIEISLRPDWFYFGQDGVLQEFVGKQVLEAKTATNTNKHHGEEYDSPAEK GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 16->133|TOXA_CLODI|2e-08|34.5|116/2710| TM:NTM 1 TM:REGION 7->29| BL:PDB:NREP 1 BL:PDB:REP 29->141|2vyuA|9e-28|52.7|112/300| RP:SCP:NREP 1 RP:SCP:REP 32->111|2bibA1|6e-07|24.1|79/232|b.109.1.1| HM:SCP:REP 10->111|2bibA1|1.3e-08|35.4|82/0|b.109.1.1|1/1|Cell wall binding repeat| OP:NHOMO 23 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------32222222231--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 85.1 SQ:SECSTR #####################ccEEEEEcccccEEEEETTEEEEEETTEEEEcEEEETTEEEEcTTTccccccEEEEEEcccccTTETTcccccccccEEEEEEcTTccccccccEEEEEccccTTccccTTccccccccE DISOP:02AL 1-2,133-142| PSIPRED cHHHHHHHHHHEEEEEEEEccEEEEEEccccEEEEEEccccEEEEEccccEEEEEEEcccEEEEEccccEEEEEEEEEccccEEEEEcccccEEEcccccEEEEcccccEEEEEcccEEEEEccccccccccccccccccc //