[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55185.1
DDBJ      :             ketol-acid reductoisomerase
Swiss-Prot:ILVC_STRP4   RecName: Full=Ketol-acid reductoisomerase;         EC=1.1.1.86;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase;

Homologs  Archaea  52/68 : Bacteria  733/915 : Eukaryota  112/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.127.1c.2.1d.58.56
:340 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->328 1np3A PDBj 5e-91 50.0 %
:RPS:PDB   17->314 3db2C PDBj 2e-27 9.7 %
:RPS:SCOP  14->102 2a10A1  d.58.56.1 * 1e-17 20.3 %
:RPS:SCOP  84->282 1qv9A  c.127.1.1 * 1e-47 14.4 %
:HMM:SCOP  3->183 1np3A2 c.2.1.6 * 4.7e-67 55.2 %
:HMM:SCOP  184->332 1qmgA1 a.100.1.2 * 1e-65 63.5 %
:RPS:PFM   16->178 PF07991 * IlvN 3e-53 65.0 %
:RPS:PFM   191->327 PF01450 * IlvC 3e-44 63.2 %
:HMM:PFM   16->178 PF07991 * IlvN 7.7e-76 64.4 163/165  
:HMM:PFM   184->327 PF01450 * IlvC 3.8e-58 57.3 143/145  
:BLT:SWISS 1->340 ILVC_STRP4 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55185.1 GT:GENE ACF55185.1 GT:PRODUCT ketol-acid reductoisomerase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 399324..400346 GB:FROM 399324 GB:TO 400346 GB:DIRECTION + GB:PRODUCT ketol-acid reductoisomerase GB:NOTE identified by match to protein family HMM PF01450; match to protein family HMM PF02629; match to protein family HMM PF07991; match to protein family HMM TIGR00465 GB:PROTEIN_ID ACF55185.1 GB:DB_XREF GI:194356737 LENGTH 340 SQ:AASEQ MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVIIGVRPGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPSLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYXDATGNAKNIXMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLADIQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN GT:EXON 1|1-340:0| SW:ID ILVC_STRP4 SW:DE RecName: Full=Ketol-acid reductoisomerase; EC=1.1.1.86;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase; SW:GN Name=ilvC; OrderedLocusNames=SPG_0409; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->340|ILVC_STRP4|0.0|100.0|340/340| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 181->190|ettykeetee| BL:PDB:NREP 1 BL:PDB:REP 7->328|1np3A|5e-91|50.0|322/327| RP:PDB:NREP 1 RP:PDB:REP 17->314|3db2C|2e-27|9.7|298/339| RP:PFM:NREP 2 RP:PFM:REP 16->178|PF07991|3e-53|65.0|163/165|IlvN| RP:PFM:REP 191->327|PF01450|3e-44|63.2|136/145|IlvC| HM:PFM:NREP 2 HM:PFM:REP 16->178|PF07991|7.7e-76|64.4|163/165|IlvN| HM:PFM:REP 184->327|PF01450|3.8e-58|57.3|143/145|IlvC| GO:PFM:NREP 6 GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF07991|IPR013116| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF07991|IPR013116| GO:PFM GO:0055114|"GO:oxidation reduction"|PF07991|IPR013116| GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF01450|IPR000506| GO:PFM GO:0009082|"GO:branched chain family amino acid biosynthetic process"|PF01450|IPR000506| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01450|IPR000506| RP:SCP:NREP 2 RP:SCP:REP 14->102|2a10A1|1e-17|20.3|79/104|d.58.56.1| RP:SCP:REP 84->282|1qv9A|1e-47|14.4|180/282|c.127.1.1| HM:SCP:REP 3->183|1np3A2|4.7e-67|55.2|181/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 184->332|1qmgA1|1e-65|63.5|148/288|a.100.1.2|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 966 OP:NHOMOORG 897 OP:PATTERN ---1--1122222231-11111111--11111111111111111121111111111-----1--1-11 1111111111111111111-111111111111111111111111111-111111111111112111112112111222-11-111111111111---11--111111111---------------11111111111111111111111111111111111111111111111111111111111111111-11122222222122222211111122211111--1111111111111111111111111111---------------------1-111-------11111111111111-------------111111111-11-11-------1-111221---1-1--111111111111-111111--1-11111111111111111111111111111111111-11111111111-111111111111111121111111111111111111111111111---------------------------11111111111111111122211111222212111111111111111111111111111111111111111111111-1111111111111-1111111111111-1121111111111111111111111111111111111-1111111111111111111111-1-111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-----------11111111111-11111111111111111111111111111111111111-1-1111-111111111111111111111111111111111111111--------------------------------------1--1-111121 --------------1111111111111-111111111111111-1111111111111-1111111111-11111111-1111111111-24211211111111212--1----------------------------------------------------------------1-1111B1111121131111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 339 STR:RPRED 99.7 SQ:SECSTR HHTTcccGGGccccccccEEEEEEcccHHHHHHHHHTTcTTEEEEEEEcccHHHHHHHHHHHTcEEcccHHHHTcTTccEEEHHHHHHHHHTTcEEEEEccccccHHHHHHHHHHHHHHcccEEEEcGGGGcHHHHHHHHHTTTTccEEEEEEEEEccHHHHccTTcGGGcTTTcTTTHHTHHHHHHHHHHHHccEEEEEEEEEcccccccccEEEEEEEETEEEEEEEcccccEEEEEEEEccEEEEEEEcGGGcccTTTGGGGEEEEEEEEccccEEEEEEccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEcHHHHcccTTTT# PSIPRED ccEEEEEcccccccHHcccEEEEEEEcccHHHHHHHHHHcccEEEEEEEccccHHHHHHcccEEccHHHHHHcccEEEEEccHHHHHHHHHHHHHHHcccccEEEEcccccEEEcEEEcccccEEEEEccccccHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHccc //