[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55205.1
DDBJ      :             Tn5253 conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->110 1z3eA PDBj 2e-05 34.7 %
:HMM:SCOP  1->109 1rw1A_ c.47.1.12 * 2.8e-05 26.2 %
:HMM:PFM   5->108 PF03960 * ArsC 1.9e-07 32.0 103/112  
:BLT:SWISS 1->114 SPX_STRMU 2e-08 29.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55205.1 GT:GENE ACF55205.1 GT:PRODUCT Tn5253 conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1255508..1255888) GB:FROM 1255508 GB:TO 1255888 GB:DIRECTION - GB:PRODUCT Tn5253 conserved hypothetical protein GB:PROTEIN_ID ACF55205.1 GB:DB_XREF GI:194356757 LENGTH 126 SQ:AASEQ MIDLYLSKNNHRNQILLDFFQNYGIEVSCHSISEMTKDKLIEMMSYSSDCFEFLSPNLLRFKNRDNLRLTDFIEMILKNPELSIRLPLAVSNKRVYPXLNLEEARALLPRDTKQLIYMAQTHYLSN GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 1->114|SPX_STRMU|2e-08|29.2|113/137| BL:PDB:NREP 1 BL:PDB:REP 32->110|1z3eA|2e-05|34.7|72/119| HM:PFM:NREP 1 HM:PFM:REP 5->108|PF03960|1.9e-07|32.0|103/112|ArsC| HM:SCP:REP 1->109|1rw1A_|2.8e-05|26.2|107/0|c.47.1.12|1/1|Thioredoxin-like| OP:NHOMO 25 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2121------211-2122-12--------------11---2-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 57.1 SQ:SECSTR ###############################HHHTccccGGGTccTTcHHHHHHcccG######GGccHHHHHHHHHHcGGG#ccccEEEccccEEEcccTTGGGGGccc################ DISOP:02AL 124-127| PSIPRED cEEEEEccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHcccccHHHcccHHHHccHHcccHHHHHHHHHHcccccccccEEEEccEEEEEccHHHHHHHccHHHHHHHHHHHHHHHcc //