[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55206.1
DDBJ      :             shikimate kinase
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  736/915 : Eukaryota  66/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:158 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->144 1zuiA PDBj 1e-21 43.6 %
:RPS:PDB   4->157 2ax4A PDBj 5e-06 18.1 %
:RPS:SCOP  4->158 1knqA  c.37.1.17 * 4e-09 21.5 %
:HMM:SCOP  1->158 1kagA_ c.37.1.2 * 7e-26 30.4 %
:RPS:PFM   9->157 PF01202 * SKI 4e-24 49.3 %
:HMM:PFM   9->157 PF01202 * SKI 8e-44 50.0 146/158  
:BLT:SWISS 1->158 AROK_STRGC 7e-45 53.2 %
:PROS 52->76|PS01128|SHIKIMATE_KINASE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55206.1 GT:GENE ACF55206.1 GT:PRODUCT shikimate kinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1277565..1278041) GB:FROM 1277565 GB:TO 1278041 GB:DIRECTION - GB:PRODUCT shikimate kinase GB:NOTE identified by match to protein family HMM PF01202 GB:PROTEIN_ID ACF55206.1 GB:DB_XREF GI:194356758 LENGTH 158 SQ:AASEQ MAKVLLGFMGAGKSTIARGLDPNYLDMDALIEKRLGMSIANFFAEKGEAAFRQVESEVLADLLQRDQVVSTGGGVVISQRNRDLLKTNTDNIYLKADFETLYLRIAADKDNQRPLFLNNSKEELVAIFQERQAWYEEVASRVLDVTKLSPEEIIEELR GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 1->158|AROK_STRGC|7e-45|53.2|158/161| PROS 52->76|PS01128|SHIKIMATE_KINASE|PDOC00868| BL:PDB:NREP 1 BL:PDB:REP 4->144|1zuiA|1e-21|43.6|133/158| RP:PDB:NREP 1 RP:PDB:REP 4->157|2ax4A|5e-06|18.1|149/198| RP:PFM:NREP 1 RP:PFM:REP 9->157|PF01202|4e-24|49.3|146/156|SKI| HM:PFM:NREP 1 HM:PFM:REP 9->157|PF01202|8e-44|50.0|146/158|SKI| GO:PFM:NREP 2 GO:PFM GO:0004765|"GO:shikimate kinase activity"|PF01202|IPR000623| GO:PFM GO:0005524|"GO:ATP binding"|PF01202|IPR000623| RP:SCP:NREP 1 RP:SCP:REP 4->158|1knqA|4e-09|21.5|149/171|c.37.1.17| HM:SCP:REP 1->158|1kagA_|7e-26|30.4|158/0|c.37.1.2|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 942 OP:NHOMOORG 809 OP:PATTERN -------------------------------------------21-22--111--------------- -11-1-111111-111111-1111111111111111-1111---1---1---111111----11-1-11-111111112221111111111111---11111111111-1--------------11111111111--11111111111111111111-11111111-11111111111111111111111-111111111111111111111111111111111111111111111111111111111111111------1---11----1--1111111111111111111111111111111111111111111111111111111111111111111---111212-1-221-111211111-1111-111111111111111122211122221------------22222111121-111111111111-1111111111111111111111-1111111-----------------------------11-1111111111111111111111111111111211121111111111-1111211-1111111111111111221-12121122-222--111211121------11-111111111-11111111111111111111121111111111111111111111111-112-111111121321222222222222-22222222222222222212222222212222222222222222222222221222222222222111111111111111111111111111111111111111111112111111111111--1111111111111111111111111111111111111111111-111--------------1---------------------------1--1-1--111 ------1-------111----------11-111111-111111-----1---------1-1-11--11-2-11-111-111-11-111--311--1---11--111---------------------------------------------------------1------------111-111111324-4211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 98.1 SQ:SECSTR ###EEEccTTccHHHHHHHHHcEEEEcHHHHTTTTTTTccccHHHHHHHHHHHHHHHHHHHHTTcEEEEEcccccHHHHHHHHHHHccEEEEEEEccHHHHHHHHHHccccHHHHHHTTccccccTTTccccccccccccEEEETTcccHHHHHHHHH PSIPRED cEEEEEccccccHHHHHHHHccccccHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHccEEEEEEccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHcc //