[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55210.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y309_STRPI   RecName: Full=UPF0297 protein SPH_0309;

Homologs  Archaea  0/68 : Bacteria  177/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->82 PF06135 * DUF965 5e-22 62.8 %
:HMM:PFM   5->82 PF06135 * DUF965 1.2e-41 59.0 78/79  
:BLT:SWISS 1->88 Y309_STRPI 4e-48 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55210.1 GT:GENE ACF55210.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 181399..181665 GB:FROM 181399 GB:TO 181665 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55210.1 GB:DB_XREF GI:194356762 LENGTH 88 SQ:AASEQ MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVGYVLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL GT:EXON 1|1-88:0| SW:ID Y309_STRPI SW:DE RecName: Full=UPF0297 protein SPH_0309; SW:GN OrderedLocusNames=SPH_0309; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|Y309_STRPI|4e-48|100.0|88/88| RP:PFM:NREP 1 RP:PFM:REP 5->82|PF06135|5e-22|62.8|78/79|DUF965| HM:PFM:NREP 1 HM:PFM:REP 5->82|PF06135|1.2e-41|59.0|78/79|DUF965| OP:NHOMO 177 OP:NHOMOORG 177 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,87-89| PSIPRED ccccHHEEEEEcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccc //