[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55214.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:850 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   605->743 3dsmA PDBj 1e-04 31.4 %
:RPS:PFM   16->831 PF09586 * YfhO 5e-99 37.8 %
:HMM:PFM   14->831 PF09586 * YfhO 7.9e-246 37.8 809/843  
:BLT:SWISS 567->824 YFHO_BACSU 1e-13 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55214.1 GT:GENE ACF55214.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 2068627..2071179 GB:FROM 2068627 GB:TO 2071179 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:PROTEIN_ID ACF55214.1 GB:DB_XREF GI:194356766 LENGTH 850 SQ:AASEQ MKSFLKTYRTYFISFIIPVVIMSGVYLSQGIYWNSDNSPLLGDGFHQYVIFDVALRNILHGNSSLFYTFTSGLGLNFYALSSYYLGSFLAPLVYFXDLTNMPDAVYLTTLLKFGLIGLSTFFSLNKLFQSIPQTLKLALSTSYALMSFTVSQLEIKTWLDVFILIPLIITGLHLLITEKKLLLYFTSLSILFIQNYYFGYMTVLFLIFWYLCQISWDFKTRKSSVLDFIVISFLAGMASLIMTLPTLFDLQTHGEKLTEVTKFQTESSWYLDLFAKQFIGSFDTTKYGAIPMIFVGLFPFILTILFFTLKSIKFHVKLIYVIFFAFLIASFYIEALDLFWQGMHTPNMFLHRYAWIFSTLLIYTAAEVLKRLKELKVWNFLVSLFLVVAGFLATIYLKSHYSFLTDLNILLTLEFLVVYSLLLLAVIKKFISVNLFAILISLFILVEMSLNASSQMDGIAKEWGFASRSAYSRDIPAMESFSTYIGNQFTRTEKLQTQTGNDSMKFNYNGISQFSSVRNRSSSSTLDKLGFKSSGTNLNLRYANNSILADSLFGIQYNISDSPIDKYGFKDIYQKDNLTLYENQYSLPIAVASQSVYNDVKFNEHTLDNQASFLNQLANVNFDYFSPIPYEKTEKIENTNDLISVTSSSNEDAAIQYQIEVPENSQVYLSFINLHFSNDKQKKVDILVNGEKKTFTTDNVFSFFNLGYTKEKKTFNINVSFPGNSQVSFESPTFYRLDTKTFTEAIQKIKEQPVTVSTSKNKVFATYDVQQDTSIFFTIPYDKGWSAYQDGKKIEIKQAQTGFMKVDIPKGKGTITLSFIPNGFITGAICSFTSLLLFGIYNHRRKSSKA GT:EXON 1|1-850:0| BL:SWS:NREP 1 BL:SWS:REP 567->824|YFHO_BACSU|1e-13|30.0|240/861| TM:NTM 12 TM:REGION 10->32| TM:REGION 80->102| TM:REGION 104->126| TM:REGION 155->177| TM:REGION 189->211| TM:REGION 226->248| TM:REGION 288->310| TM:REGION 320->342| TM:REGION 347->369| TM:REGION 376->397| TM:REGION 404->426| TM:REGION 431->453| SEG 172->183|lhllitekklll| SEG 297->309|lfpfiltilfftl| SEG 410->426|lltleflvvysllllav| SEG 512->524|sqfssvrnrssss| BL:PDB:NREP 1 BL:PDB:REP 605->743|3dsmA|1e-04|31.4|118/320| RP:PFM:NREP 1 RP:PFM:REP 16->831|PF09586|5e-99|37.8|792/813|YfhO| HM:PFM:NREP 1 HM:PFM:REP 14->831|PF09586|7.9e-246|37.8|809/843|YfhO| OP:NHOMO 101 OP:NHOMOORG 80 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1--1---11---1111-------------1------------------------2-4122112-322112221211111111111111331111111111111111111111111111111111-----------------------------31--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 19.8 SQ:SECSTR ############################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################EEEETTEEEEEEccccEEEEEETTTTEEEEEEEcTTcccccccTTcccccEEETTEEEEEEcTTccEEEEEEETTTTEEEEEEEccccccccEccEEEEcccccTHHHHHHHTTTccccTccccccccEEEEEETTTTEHHEEEEcccccccccHHHHHHHcccccHH############################################################################## DISOP:02AL 1-1,633-635,637-642,849-851| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHcccccccHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccEEccccccccccccEEccccccEEEEEccccHHHHHHHHccccccccEEEEEEcccHHHHHHHcccEEEcccccccccccccccccccEEEEEccccccEEEcccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEEEEccccEEEEEEEcccccccccccEEEEEccEEEEEEcccEEEEEEEEEcccccEEEEEEEEccccEEEEEccEEEEccHHHHHHHHHHHHHcccEEEEEccEEEEEEEccccEEEEEEcccccccEEEEccEEccHHHHHHHHHEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHEHHccc //