[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55218.1
DDBJ      :             PTS system, IID component
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  210/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->243 PF03613 * EIID-AGA 1e-48 42.6 %
:HMM:PFM   7->267 PF03613 * EIID-AGA 5.2e-91 42.5 259/264  
:BLT:SWISS 24->243 PTND_ECOLI 3e-34 36.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55218.1 GT:GENE ACF55218.1 GT:PRODUCT PTS system, IID component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 66601..67416 GB:FROM 66601 GB:TO 67416 GB:DIRECTION + GB:PRODUCT PTS system, IID component GB:NOTE identified by match to protein family HMM PF03613 GB:PROTEIN_ID ACF55218.1 GB:DB_XREF GI:194356770 LENGTH 271 SQ:AASEQ MTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQLRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNGIKTGLMGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEFAYKEGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQDILNQIFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 24->243|PTND_ECOLI|3e-34|36.8|220/286| TM:NTM 5 TM:REGION 104->126| TM:REGION 131->153| TM:REGION 177->199| TM:REGION 220->241| TM:REGION 248->270| SEG 250->264|aigiiivlalalsal| RP:PFM:NREP 1 RP:PFM:REP 7->243|PF03613|1e-48|42.6|235/263|EIID-AGA| HM:PFM:NREP 1 HM:PFM:REP 7->267|PF03613|5.2e-91|42.5|259/264|EIID-AGA| GO:PFM:NREP 2 GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03613|IPR004704| GO:PFM GO:0016021|"GO:integral to membrane"|PF03613|IPR004704| OP:NHOMO 567 OP:NHOMOORG 211 OP:PATTERN ----------------1--------------------------------------------------- ------------------------------------------------------------------------------3--------------------------------------------------------------------------------------------------------------------------1-------1-11-1-------1--444444----------------------D1116E1131522--6714522211132344443334443343444433333333333333341113333---29111-1--312-5---442---1-3--------------111-212------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-----1------------------------------2---------------------1----1--1------------311133-2444254543-4323444443454332334433122213432333443324223322244221-222222212222111---------------2222121----2111----------------------------------------112--------12-----------------1---------------------------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-9,88-94| PSIPRED cccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEcccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccc //