[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55219.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  301/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.22.1
:319 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->286 2nq2A PDBj 2e-10 24.7 %
:RPS:SCOP  34->285 1l7vA  f.22.1.1 * 3e-27 19.9 %
:HMM:SCOP  1->313 1l7vA_ f.22.1.1 * 5.8e-60 32.0 %
:RPS:PFM   35->291 PF01032 * FecCD 1e-20 29.9 %
:HMM:PFM   10->312 PF01032 * FecCD 1.3e-70 34.0 303/311  
:BLT:SWISS 22->291 YCLN_BACSU 1e-46 37.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55219.1 GT:GENE ACF55219.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1689467..1690426 GB:FROM 1689467 GB:TO 1690426 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF01032 GB:PROTEIN_ID ACF55219.1 GB:DB_XREF GI:194356771 LENGTH 319 SQ:AASEQ MKLSHYLIGLLLLLVFLSISIGTSDFSWGKLFDFDQQTWLLFQESRLPRTISILLTASSMSMAGLLMQTITQNQFAAPSTVGTTEAAKLGMVLSLFVFPSASLTQKMLFAFISSIVFTLFFLAFMTIFTVKERWMLPLIGIIYSGIIGSVTEVIAYRFNLVQSMTAWTQGSFSMIQTHQYEWLFLGLIILITVWKLSQTFTIMNLGKETSESLGISYSLLEKLALFLVALTTSVTMITVGGLPFLGVIVPNLVRKRYGDNLSQTKLMVALVGANLVLACDILSRVLIRPYELSVSLLLGIIGSLVFILLLWRGGRKDAD GT:EXON 1|1-319:0| BL:SWS:NREP 1 BL:SWS:REP 22->291|YCLN_BACSU|1e-46|37.8|270/316| TM:NTM 8 TM:REGION 8->30| TM:REGION 56->78| TM:REGION 98->120| TM:REGION 136->158| TM:REGION 180->202| TM:REGION 222->244| TM:REGION 264->286| TM:REGION 291->313| SEG 3->21|lshyliglllllvflsisi| SEG 139->149|igiiysgiigs| SEG 219->230|lleklalflval| SEG 292->310|lsvslllgiigslvfilll| BL:PDB:NREP 1 BL:PDB:REP 46->286|2nq2A|2e-10|24.7|235/308| RP:PFM:NREP 1 RP:PFM:REP 35->291|PF01032|1e-20|29.9|251/313|FecCD| HM:PFM:NREP 1 HM:PFM:REP 10->312|PF01032|1.3e-70|34.0|303/311|FecCD| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01032|IPR000522| GO:PFM GO:0006810|"GO:transport"|PF01032|IPR000522| GO:PFM GO:0016020|"GO:membrane"|PF01032|IPR000522| RP:SCP:NREP 1 RP:SCP:REP 34->285|1l7vA|3e-27|19.9|251/324|f.22.1.1| HM:SCP:REP 1->313|1l7vA_|5.8e-60|32.0|309/324|f.22.1.1|1/1|ABC transporter involved in vitamin B12 uptake, BtuC| OP:NHOMO 495 OP:NHOMOORG 315 OP:PATTERN --------------------------------------11111---111-31--1111---------- -----1-11111-2-----------------------1----1-1-111---11-11-111----1---------------1------11---1-------1-1----------------------------------------------11-----------1---11-------------------11--133333234334533351322433541121322------53133333443333333322241----------11-1--1--------111-----1111111111111-------------1--111---1-15--444433435324---12123-1-1----42-----------1-21-------11-11-----11-1--1-11111111111--------------11----11--1-------11-1------------------------------------------------------11------------------------------------------1--------------1111111-------1--------1-----------12----1--------1111-----------1-1--11-13--------11221--2---1--121-1------------------1-1111111111-1111111111112111111---11112-----------------1111111--111111111111-----------------4111112-----1--311111---11------1----1-----------------233-1111141322------------------11------------1-1--------------------------12--11111--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 77.7 SQ:SECSTR ###############################TccccccccGGGT#HHHHHHHHHHHHHHHHHHHHHHHHHTTcTTccTTTTcHHHHHHHHHHHHHHTTcc######HHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHcccTHHHHHHHTTcccTTccHHHHHHHHHHHHHHHHHHHHTTTGGGGGGccHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHccccccTTHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHc################################# DISOP:02AL 1-1,312-312,316-320| PSIPRED cHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccc //