[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55223.1
DDBJ      :             MutT/nudix family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->96 3gwyB PDBj 6e-07 37.3 %
:RPS:PDB   4->156 3dkuF PDBj 1e-14 25.9 %
:RPS:SCOP  6->148 1ryaA  d.113.1.5 * 1e-12 18.5 %
:HMM:SCOP  1->144 1ryaA_ d.113.1.5 * 3.1e-21 25.0 %
:RPS:PFM   15->74 PF00293 * NUDIX 7e-06 40.4 %
:HMM:PFM   12->132 PF00293 * NUDIX 3e-14 23.6 110/135  
:BLT:SWISS 2->80 ADPP_BACSU 1e-06 39.2 %
:PROS 38->59|PS00893|NUDIX_BOX

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55223.1 GT:GENE ACF55223.1 GT:PRODUCT MutT/nudix family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 702259..702759 GB:FROM 702259 GB:TO 702759 GB:DIRECTION + GB:PRODUCT MutT/nudix family protein GB:NOTE identified by match to protein family HMM PF00293 GB:PROTEIN_ID ACF55223.1 GB:DB_XREF GI:194356775 LENGTH 166 SQ:AASEQ MEIKKHFGVYAVCLENGKLLCIEKTRGPYQHRYDLPGGSQQLGEGLTETLTREVMEETGFTVRSYSNPRIYDVFVREELTNFMVHHVMALYDVEMNESAPQVTTSEAVSDGANDSLGYIWMDIQEITEENASPLVLKVKSELLGFPELDKTSYMNWKVNDEKSTCP GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 2->80|ADPP_BACSU|1e-06|39.2|79/185| PROS 38->59|PS00893|NUDIX_BOX|PDOC00695| BL:PDB:NREP 1 BL:PDB:REP 9->96|3gwyB|6e-07|37.3|75/133| RP:PDB:NREP 1 RP:PDB:REP 4->156|3dkuF|1e-14|25.9|139/149| RP:PFM:NREP 1 RP:PFM:REP 15->74|PF00293|7e-06|40.4|57/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 12->132|PF00293|3e-14|23.6|110/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 6->148|1ryaA|1e-12|18.5|135/160|d.113.1.5| HM:SCP:REP 1->144|1ryaA_|3.1e-21|25.0|136/160|d.113.1.5|1/1|Nudix| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- 1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-11-1-1--1------11------1--------1------------------------11-----11--11----1-111----------11111111111------------------1--------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 93.4 SQ:SECSTR cccccEEEEEEEEEETTEEEEEEEEcccccEEEEccEEEccTTccHHHHHHHHHHHHHcccccccEEEEEEEEEcTTccETTEcEEEEEEEEEEcccccccccccTTEEEccTTccEEEEEcHHHHHTccccTHHHHHHHHHHTcc#GGGGccccc########## DISOP:02AL 1-2,161-167| PSIPRED cccEEEEEEEEEEEEccEEEEEEEcccccccEEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEcccccccccccccccccccccEEEEEcHHHcccccccHHHHHHHHHHHcccccccccccccEEcccccccc //