[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55227.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.79.8
:148 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  3->125 2ohwA1  d.79.8.1 * 1e-09 21.0 %
:RPS:PFM   3->122 PF07997 * DUF1694 2e-14 36.2 %
:HMM:PFM   1->122 PF07997 * DUF1694 2.1e-33 36.4 118/120  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55227.1 GT:GENE ACF55227.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1006179..1006625) GB:FROM 1006179 GB:TO 1006625 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF07997 GB:PROTEIN_ID ACF55227.1 GB:DB_XREF GI:194356779 LENGTH 148 SQ:AASEQ MTDLSKQLLEKAHGGLKINPDEQRRYLGTFEERVLGYVDIDTANSPQLEKGFLFILENLQEKAEPLFVKISPTIEFDKQVFYLKEAKETDSQATIVSEEHITSPFGLVIHSNAPVQVEEKDLRLAFPKLWEVKKEEPAKTSLWKKWFS GT:EXON 1|1-148:0| RP:PFM:NREP 1 RP:PFM:REP 3->122|PF07997|2e-14|36.2|116/119|DUF1694| HM:PFM:NREP 1 HM:PFM:REP 1->122|PF07997|2.1e-33|36.4|118/120|DUF1694| RP:SCP:NREP 1 RP:SCP:REP 3->125|2ohwA1|1e-09|21.0|119/128|d.79.8.1| OP:NHOMO 44 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------11111111111111111111111111111111111-11111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,127-141| PSIPRED cccHHHHHHHHccccccccHHHHHHHHcccHHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccccEEEEccccccccEEEEEEEccccccccccHHHHccccccccccccHHHHHHHHHHc //