[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55228.1
DDBJ      :             5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  458/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.56.2
:230 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->230 1zosA PDBj e-120 94.8 %
:RPS:PDB   1->229 3df9A PDBj 1e-48 39.7 %
:RPS:SCOP  1->229 1jysA  c.56.2.1 * 1e-42 40.0 %
:HMM:SCOP  1->229 1t8sA_ c.56.2.1 * 3.6e-73 38.7 %
:RPS:PFM   30->200 PF01048 * PNP_UDP_1 2e-18 33.5 %
:HMM:PFM   2->227 PF01048 * PNP_UDP_1 1.5e-54 36.2 224/234  
:BLT:SWISS 1->229 MTNN_LISW6 5e-54 46.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55228.1 GT:GENE ACF55228.1 GT:PRODUCT 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 880803..881495 GB:FROM 880803 GB:TO 881495 GB:DIRECTION + GB:PRODUCT 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase GB:NOTE identified by match to protein family HMM PF01048; match to protein family HMM TIGR01704 GB:PROTEIN_ID ACF55228.1 GB:DB_XREF GI:194356780 LENGTH 230 SQ:AASEQ MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHALNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKALD GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 1->229|MTNN_LISW6|5e-54|46.3|229/233| SEG 176->184|aaiaqaaha| BL:PDB:NREP 1 BL:PDB:REP 1->230|1zosA|e-120|94.8|230/230| RP:PDB:NREP 1 RP:PDB:REP 1->229|3df9A|1e-48|39.7|229/234| RP:PFM:NREP 1 RP:PFM:REP 30->200|PF01048|2e-18|33.5|170/229|PNP_UDP_1| HM:PFM:NREP 1 HM:PFM:REP 2->227|PF01048|1.5e-54|36.2|224/234|PNP_UDP_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01048|IPR000845| GO:PFM GO:0009116|"GO:nucleoside metabolic process"|PF01048|IPR000845| RP:SCP:NREP 1 RP:SCP:REP 1->229|1jysA|1e-42|40.0|225/226|c.56.2.1| HM:SCP:REP 1->229|1t8sA_|3.6e-73|38.7|225/0|c.56.2.1|1/1|Purine and uridine phosphorylases| OP:NHOMO 513 OP:NHOMOORG 461 OP:PATTERN -------------------------------------------------------------------- -----------------11-1---11111111--------------11-------1-------1-------111111111-1---------1--11----1-----111----------------------------------------1---11--111-----------------1----1111------11333232432333333121111433111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111122111--1-11-----------------11-1----1-----------------------------------------------------------------------------------1------------------------------------111--1---1111111111111111--11-111----111---111---1--------1111111-1--------2-----1----1-11--1---------11111111111111111111111111--1111--1-11111111112111111211111-1----11-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1-------------11111111111111111------1----------------------111111111111111111112111-----------------1------43312111111----1---1--------11---111-1--1-------- -----------2------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 230 STR:RPRED 100.0 SQ:SECSTR cEEEEEEccHHHHHHHHHTcEEEEEEEETTEEEEEEEETTEEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEEEEEccTTccTTcEEEEEEEEEcccccGGGTccTTccTTccccEEccHHHHHHHHHHHHHHTccEEEEEEEEcccccccHHHHHHHHHHcTTEEEEEccHHHHHHHHHHTTccEEEEEEEEEcccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHH PSIPRED cEEEEEcccHHHHHHHHHHcccccEEEEcccEEEEEEEccEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccEEEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEcccEEccHHHHHHHHHHccccEEEEccHHHHHHHHHHccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHc //