[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55232.1
DDBJ      :             glycosyl transferase, group 2 family protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  382/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:290 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->128 2z87B PDBj 9e-14 38.3 %
:RPS:PDB   1->274 3ckjA PDBj 8e-23 11.8 %
:RPS:SCOP  10->117 1omxA  c.68.1.15 * 1e-18 13.7 %
:HMM:SCOP  9->252 1qg8A_ c.68.1.1 * 1e-40 29.8 %
:RPS:PFM   11->118 PF00535 * Glycos_transf_2 2e-18 39.6 %
:HMM:PFM   11->122 PF00535 * Glycos_transf_2 2.4e-31 35.5 110/169  
:BLT:SWISS 5->267 Y1057_METJA 1e-18 24.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55232.1 GT:GENE ACF55232.1 GT:PRODUCT glycosyl transferase, group 2 family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 138836..139708 GB:FROM 138836 GB:TO 139708 GB:DIRECTION + GB:PRODUCT glycosyl transferase, group 2 family protein GB:NOTE identified by match to protein family HMM PF00535 GB:PROTEIN_ID ACF55232.1 GB:DB_XREF GI:194356784 LENGTH 290 SQ:AASEQ MDRNIDQELVSIIIPTHNRYESLIRAVKSCLHQSYKNIEVIIIDDNYSNVNLRNKIIHQFGYTNHRIKLILSNEDLGATNARNIGIKNSRGKYISFLDDDDEYMPDRILKLMACFKKSRMKNLALVYSYGIIIYPNGTREEEKTDFVGNPLFVQMVHNIAGTSFWLCKKEVLELINGFEKIDSHQDGVVLLKLLAQGYQIDIVREFLVNYYAHSKENGITGVTQKTINADEEYYNYCRKYFNLLSFNERILVTKKYYSLNIKRLLLIGDKCKALKVIKKAREEKIFNEFF GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 5->267|Y1057_METJA|1e-18|24.5|257/290| BL:PDB:NREP 1 BL:PDB:REP 9->128|2z87B|9e-14|38.3|115/591| RP:PDB:NREP 1 RP:PDB:REP 1->274|3ckjA|8e-23|11.8|263/300| RP:PFM:NREP 1 RP:PFM:REP 11->118|PF00535|2e-18|39.6|106/148|Glycos_transf_2| HM:PFM:NREP 1 HM:PFM:REP 11->122|PF00535|2.4e-31|35.5|110/169|Glycos_transf_2| RP:SCP:NREP 1 RP:SCP:REP 10->117|1omxA|1e-18|13.7|102/250|c.68.1.15| HM:SCP:REP 9->252|1qg8A_|1e-40|29.8|238/255|c.68.1.1|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 825 OP:NHOMOORG 414 OP:PATTERN --------2222-2----1-----3-------53--1---311-21--12122-1121211--1---1 -------1--------------------------------1--------------1-----------11--4111-1--1-1--2-146892-611---4-23312-2-3--------------2212-324-2-2----1-----1189332----2----1-2229C55--1--11---1------211--2333335422243444241221422---13-1---111211------------------24---332--1111--23231---112122-------42252436271-------------333213333----53111-121233-3---41---3--14---11-11-1-1-------2-11---------2-1------------------------1--2--22--111123122412--1--------11-----------32132-1------------2222222222222------------------1-------11-3--------------1---11----1----1----13-----1111--1--1-4221-31-11---1-81-31413----1-121-212232132-1--1--1---133-----2122111----2-11-21----11111---11-2------22---121222122223-22124123212212212211-2---31111-1111111-1111211---12----------------1----------1121-----1--23221--3----------4211111-1-1-----111322222222-1--1-------2-------------------2223333---------------------1-------1------2-----2-1-131 ----31--------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 289 STR:RPRED 99.7 SQ:SECSTR HHHTTTTccEEEEEEEcccTTTHHHHHHHHGGGcTTTccEEEEEEccccccHHHHHHTTcEEEEHHHHcTTccccccHHHHHHHHHHHccccEEEEccTTEEcccTTHHHHHHHHHcEEHccccccEEEEEEEcccHTHHHHHHHHTHHHHHHHHcGGGTTcccEEEEHHHHTTcccccGGHHGHHHHHHHHHHHHHcGGGEEEEEEEEEcEEccGGGHHHHHHHHHHHHHHHTTccccccccEEEEEccTTcccEEEEEccccccccccGGGTcccccHHHHHHGGGc# DISOP:02AL 1-5,217-220| PSIPRED cccccccccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccccEEEEEEcccEEcHHHHHHHHHHHHHcccccEEEEEccEEEEccccccccccccccccHHHHHHHcccccccEEEEEHHHHHHcccccccccHHHHHHHHHHHHccccEEEEcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHc //