[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55240.1
DDBJ      :             dimethyladenosine transferase
Swiss-Prot:KSGA_STRPI   RecName: Full=Dimethyladenosine transferase;         EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase;

Homologs  Archaea  54/68 : Bacteria  907/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:290 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->286 3fuxC PDBj 3e-40 41.4 %
:RPS:PDB   22->209 3bt7A PDBj 9e-17 12.2 %
:RPS:PDB   184->286 3doaA PDBj 2e-05 9.5 %
:RPS:SCOP  26->286 1qyrA  c.66.1.24 * 4e-66 33.3 %
:HMM:SCOP  13->292 1i4wA_ c.66.1.24 * 5e-81 38.8 %
:RPS:PFM   21->281 PF00398 * RrnaAD 2e-64 51.2 %
:HMM:PFM   19->249 PF00398 * RrnaAD 1.3e-66 35.4 226/262  
:BLT:SWISS 1->290 KSGA_STRPI e-164 100.0 %
:PROS 50->77|PS01131|RRNA_A_DIMETH

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55240.1 GT:GENE ACF55240.1 GT:PRODUCT dimethyladenosine transferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1799023..1799895) GB:FROM 1799023 GB:TO 1799895 GB:DIRECTION - GB:PRODUCT dimethyladenosine transferase GB:NOTE identified by match to protein family HMM PF00398; match to protein family HMM TIGR00755 GB:PROTEIN_ID ACF55240.1 GB:DB_XREF GI:194356792 LENGTH 290 SQ:AASEQ MRIADYSVTKAVLERHGFTFKKSFGQNFLTDTNILQKIVDTAEIDDQVNVIEIGPGIGALTEFLAERAAQVMAFEIDHRLVPILVDTLRDFDNVTVVNEDILKVDLAQHIQNFKNPNLPIKVVANLPYYITTPILMHLIESGIPFCEFVVMMQKEVADRISAQPNTKAYGSLSIAVQYYMTAKVAFIVPRTVFVPAPNVDSAILKMVRRPEPAVAVEDENFFFKVSKASFTHRRKTLWNNLTGYFGKTEEVKDKLTKALDQAGLSPSVRGEALSLAEFAGLADALKGQGL GT:EXON 1|1-290:0| SW:ID KSGA_STRPI SW:DE RecName: Full=Dimethyladenosine transferase; EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase; SW:GN Name=ksgA; OrderedLocusNames=SPH_2126; SW:KW Antibiotic resistance; Complete proteome; Methyltransferase;RNA-binding; rRNA processing; S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->290|KSGA_STRPI|e-164|100.0|290/290| GO:SWS:NREP 5 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 50->77|PS01131|RRNA_A_DIMETH|PDOC00871| BL:PDB:NREP 1 BL:PDB:REP 3->286|3fuxC|3e-40|41.4|263/265| RP:PDB:NREP 2 RP:PDB:REP 22->209|3bt7A|9e-17|12.2|181/369| RP:PDB:REP 184->286|3doaA|2e-05|9.5|95/266| RP:PFM:NREP 1 RP:PFM:REP 21->281|PF00398|2e-64|51.2|248/256|RrnaAD| HM:PFM:NREP 1 HM:PFM:REP 19->249|PF00398|1.3e-66|35.4|226/262|RrnaAD| GO:PFM:NREP 3 GO:PFM GO:0000154|"GO:rRNA modification"|PF00398|IPR001737| GO:PFM GO:0000179|"GO:rRNA (adenine-N6,N6-)-dimethyltransferase activity"|PF00398|IPR001737| GO:PFM GO:0008649|"GO:rRNA methyltransferase activity"|PF00398|IPR001737| RP:SCP:NREP 1 RP:SCP:REP 26->286|1qyrA|4e-66|33.3|249/252|c.66.1.24| HM:SCP:REP 13->292|1i4wA_|5e-81|38.8|268/0|c.66.1.24|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1312 OP:NHOMOORG 1144 OP:PATTERN --1111----------1111111111111111111111111111111111111111111111111--1 1111211111121211121-2111112222211111111111111111111111111111121111212111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111112111111111123613111123331111421211111111111111111111111111111111111111422111111111111121111111111211111211111111111113111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-11111111111111111111111111111111 22-1221-411122111111111111-11-1111111111111---1111111111111111111111111111111-1111111111-1211111111111122212-2432223-212112222-21272-2222--231231122122-231221211221221423142222122F2222222331322232223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 286 STR:RPRED 98.6 SQ:SECSTR #cGcTTcccTTTTcTTHHHHHTccccccHHHHHHHHHHHHHHTTTcccEEEEEccTTcHHHHHHGGGccEEEEEcccHHHHHHHHHHHHHTTcccEEEEcEEccGGGcccHHHHHHHccccccTTGGGccGGGccEEEEEEcccTTcccHHHHHHHTTccEEEEEEccHHHHHHHHHHHHHHEEEEEEEEEcccTTccccEEEEEEEEcEEEEEEEEEEccccEEEEEEccccHHHHHHHHHHHHTTcEEEEHHHHHHHEEETTEEccTTccccccEEEEEEccccT### DISOP:02AL 1-5| PSIPRED cccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHHcccccEEEEEccEEcccHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHccccccEEEEEEEHHHHHHHHcccccccccHHHHHHHHHEEEEEEEEEcHHHcccccccEEEEEEEEEccccccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccc //