[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55241.1
DDBJ      :             phosphate binding protein, putative
Swiss-Prot:PSTS1_STRR6  RecName: Full=Phosphate-binding protein pstS 1;         Short=PBP 1;Flags: Precursor;

Homologs  Archaea  26/68 : Bacteria  416/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.94.1
:292 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->271 1twyF PDBj 5e-27 32.5 %
:RPS:PDB   33->282 2capA PDBj 1e-28 16.1 %
:RPS:SCOP  32->282 1a40A  c.94.1.1 * 5e-43 25.1 %
:HMM:SCOP  21->289 1pc3A_ c.94.1.1 * 3.3e-64 36.2 %
:HMM:PFM   43->260 PF01547 * SBP_bac_1 2.4e-05 21.9 210/314  
:BLT:SWISS 1->292 PSTS1_STRR6 e-165 99.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55241.1 GT:GENE ACF55241.1 GT:PRODUCT phosphate binding protein, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1307336..1308214) GB:FROM 1307336 GB:TO 1308214 GB:DIRECTION - GB:PRODUCT phosphate binding protein, putative GB:NOTE identified by match to protein family HMM PF01547; match to protein family HMM TIGR02136 GB:PROTEIN_ID ACF55241.1 GB:DB_XREF GI:194356793 LENGTH 292 SQ:AASEQ MKKRKKLALSLIAFWLTACLVGCASWIDRGESITAVGSTALQPLVEVAADEFGTIHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVDHKVAVAGLALIVNKEVDVDNLTTEXLRQIFIGEVTNWKEVGGKDLPISVINRAAGSGSRATFDTVIMEGQSAMQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLSPENISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGLKYIPIKEMKVEKDAAGTVTVLEGRQ GT:EXON 1|1-292:0| SW:ID PSTS1_STRR6 SW:DE RecName: Full=Phosphate-binding protein pstS 1; Short=PBP 1;Flags: Precursor; SW:GN Name=pstS1; OrderedLocusNames=spr1257; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Phosphate transport; Signal; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->292|PSTS1_STRR6|e-165|99.7|292/292| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006817|"GO:phosphate transport"|Phosphate transport| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 7->29| BL:PDB:NREP 1 BL:PDB:REP 33->271|1twyF|5e-27|32.5|234/241| RP:PDB:NREP 1 RP:PDB:REP 33->282|2capA|1e-28|16.1|249/376| HM:PFM:NREP 1 HM:PFM:REP 43->260|PF01547|2.4e-05|21.9|210/314|SBP_bac_1| RP:SCP:NREP 1 RP:SCP:REP 32->282|1a40A|5e-43|25.1|247/321|c.94.1.1| HM:SCP:REP 21->289|1pc3A_|3.3e-64|36.2|268/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 633 OP:NHOMOORG 443 OP:PATTERN ------------------------122-122-112--22111211112211121-------------- -----1--111-------------------------1----2-2----------1-----------1-2-----------11------111111--------1----------------------22-22123221---111111-435222211111-1112-1-221511---11111--1-----11---12222212212221121-111122112121-111111122111111111111111-111-21212211111221122211222222111122211111111111111111111111111112211111122231111111111111111-222311113111111321-211111121-----------------1------------------------------------------------------------22222222-11--------------------------------------------------------------------------21-12-111-1----1-1-----1--------------2311-11211221133-3--12311111-24---------------------1-----111--11--12-----111---1-112111---2112--------1-111133-111123-3312311232311311222--------3121312222212112-11-1112-----------------2-----------1-1-------------------------11-1-1--112----2222---------112232222212222----------------11111---11111111----------------------------1111111111-21 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------ STR:NPRED 267 STR:RPRED 91.4 SQ:SECSTR ###############ccEEEEEccTTccTTcEccEEEccTTHHHHTcTTTccTTccHHHHHHHHHHTcGGGTcccTTccccEEEEcccHHHHHHHHHHTEEEEEEEEEEccccccccccccEEcHHHHHHHHHTccccGGGcTTcccccEEEEEccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcTTccccEEccccHHHHcccGGGGGccEEETTEEEccccccccEEEEEEEEEccccHHHHHHHHTccccccHHHHHHHTTcccccHHHHHHHHH########## DISOP:02AL 1-4,90-94,179-180,289-293| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHcccccEEEccccccHHHHHccccEEEEEEEEEEEEEEEccccccHHccHHHHHHHHccccccccccccccccEEEEEccccccHHHHHHHHHccccccccccccccHHHHHHHHHcccccEEEEEHHHccccccEEEEccEEcccHHcccccccEEEEEEEEEcccccHHHHHHHHHHHcHHHHHHHHHHcccccccHHHHHHHHcccEEcccccc //