[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55245.1
DDBJ      :             Transcriptional activator TenA
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  218/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
a.132.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->218 2qcxB PDBj 1e-34 32.1 %
:RPS:PDB   2->213 2a6bA PDBj 3e-29 20.9 %
:RPS:SCOP  1->215 1uddA  a.132.1.3 * 4e-51 23.8 %
:HMM:SCOP  2->218 1to9A_ a.132.1.3 * 2.4e-63 34.6 %
:RPS:PFM   15->212 PF03070 * TENA_THI-4 2e-25 32.8 %
:HMM:PFM   12->214 PF03070 * TENA_THI-4 1.3e-44 29.6 203/210  
:BLT:SWISS 1->218 TENA_BACSU 1e-34 32.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55245.1 GT:GENE ACF55245.1 GT:PRODUCT Transcriptional activator TenA GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 642283..642975 GB:FROM 642283 GB:TO 642975 GB:DIRECTION + GB:PRODUCT Transcriptional activator TenA GB:NOTE identified by match to protein family HMM PF03070 GB:PROTEIN_ID ACF55245.1 GB:DB_XREF GI:194356797 LENGTH 230 SQ:AASEQ MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLADKTSNQEMKRLLKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWEMAYQHQTWKSDLQSLEKGEE GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 1->218|TENA_BACSU|1e-34|32.6|218/236| BL:PDB:NREP 1 BL:PDB:REP 1->218|2qcxB|1e-34|32.1|218/227| RP:PDB:NREP 1 RP:PDB:REP 2->213|2a6bA|3e-29|20.9|206/216| RP:PFM:NREP 1 RP:PFM:REP 15->212|PF03070|2e-25|32.8|198/208|TENA_THI-4| HM:PFM:NREP 1 HM:PFM:REP 12->214|PF03070|1.3e-44|29.6|203/210|TENA_THI-4| RP:SCP:NREP 1 RP:SCP:REP 1->215|1uddA|4e-51|23.8|210/215|a.132.1.3| HM:SCP:REP 2->218|1to9A_|2.4e-63|34.6|217/225|a.132.1.3|1/1|Heme oxygenase-like| OP:NHOMO 348 OP:NHOMOORG 297 OP:PATTERN 11--1-1122222222-111111-1---1122-----------------------11---111----- -------------1-------1---1------1111-111-1------1---1111----------1---1-1111-1----1------------------------11----------------------------1111---12--1---11111----------1-111----11-1--1--------11122222222222222221222122211--2111111111121111111111111-211111-1-11-1-------111-111-111111-------22222222221---------------------------1-------1-1-----11------------------1-----------------------1----1-----11111111111-11-11111--------11-111-------1-1----21----------11------------------------------1-12-------------------------------------------------------11------------------------2--------------------------------111111--1111111-----------------1---------------------------------------------------------------------111-------------------------------------------------------------111----1111---11111111--------------------------------1111-----111-------------------111----------------------------------------------------- ---------------11---1111--11111111-1-1111111-1----1-11-11---11--------------1--1----1-11--2111---------11----1-------------------------------------------------------------------------111---1-111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 96.1 SQ:SECSTR cHHHHHHHHTTHHHHHHHHTcHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHTTccHHHHHTccccHHHHHHHHHHHHHHHTcHHGGHHHHHHHHHHHHHHHHTccccccccHHTHHHHHHTTccHHHHHHHHHHHHHHHHHTTHTTcTTHHHHHHHHHHHHHHHHHHHHGGGHHHHTTcT######### DISOP:02AL 221-231| PSIPRED ccHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccc //