[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55254.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  216/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.1.8c.1.9
:94 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->92 3fj0A PDBj 3e-10 39.8 %
:RPS:PDB   3->92 1e4nA PDBj 1e-14 27.7 %
:RPS:SCOP  2->83 1j5sA  c.1.9.8 * 2e-11 11.7 %
:HMM:SCOP  1->95 1e6qM_ c.1.8.4 * 3.4e-20 42.9 %
:RPS:PFM   2->92 PF00232 * Glyco_hydro_1 9e-16 53.0 %
:HMM:PFM   6->92 PF00232 * Glyco_hydro_1 9.2e-22 40.0 80/455  
:BLT:SWISS 7->92 ASCB_ECOLI 5e-27 63.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55254.1 GT:GENE ACF55254.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 653206..653490 GB:FROM 653206 GB:TO 653490 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE contains potential frameshift; identified by glimmer; putative GB:PROTEIN_ID ACF55254.1 GB:DB_XREF GI:194356806 LENGTH 94 SQ:AASEQ MDTPDENGYVADDYRITXFRRPXSRPCXNAIYKDGVDLLGYTTWGCIDSVSAGTGEMNKRYGFIYVDRDNVGNGTLKRSKKKSFYWYMSFIAMV GT:EXON 1|1-94:0| BL:SWS:NREP 1 BL:SWS:REP 7->92|ASCB_ECOLI|5e-27|63.1|84/474| BL:PDB:NREP 1 BL:PDB:REP 2->92|3fj0A|3e-10|39.8|83/439| RP:PDB:NREP 1 RP:PDB:REP 3->92|1e4nA|1e-14|27.7|83/489| RP:PFM:NREP 1 RP:PFM:REP 2->92|PF00232|9e-16|53.0|83/450|Glyco_hydro_1| HM:PFM:NREP 1 HM:PFM:REP 6->92|PF00232|9.2e-22|40.0|80/455|Glyco_hydro_1| GO:PFM:NREP 2 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF00232|IPR001360| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00232|IPR001360| RP:SCP:NREP 1 RP:SCP:REP 2->83|1j5sA|2e-11|11.7|77/451|c.1.9.8| HM:SCP:REP 1->95|1e6qM_|3.4e-20|42.9|84/0|c.1.8.4|1/1|(Trans)glycosidases| OP:NHOMO 542 OP:NHOMOORG 218 OP:PATTERN -------------------------------------------------------------------- ----------2-1----------------------------------------11--------1---------------------------------------------------------------------------------------------------------------------------------3-------11--1---1244531---22--13677867---11111111111111----3681-44--515AA--341-54345572225111333332322323-2111111111111131122-1118---582223213111-9-----1---1-1-1------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1-4-------1--------------------------------3464-613223344444-23343234342422333335657812-111111111111111132211123--311111111111---------------------1----------------------------------------------------1-11111111-------------------1---------------------8-------------2------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 98.9 SQ:SECSTR ETcccHHHHHccHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEEcccccccGGGTETcEEcccEEEETTTcTTTTTEEEEcHHHHHHHHHHHE# PSIPRED ccccccccEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHccccccccccccEEEEEEccccccccccEEEEcHHHHHHHHHHHHc //