[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55267.1
DDBJ      :             IS3-Spn1, transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  489/915 : Eukaryota  3/199 : Viruses  3/175   --->[See Alignment]
c.55.3
:277 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   134->273 1b9dA PDBj 1e-14 12.0 %
:RPS:SCOP  121->273 1b92A  c.55.3.2 * 4e-16 12.9 %
:HMM:SCOP  108->276 1c0mA2 c.55.3.2 * 2.4e-29 27.6 %
:RPS:PFM   129->226 PF00665 * rve 8e-06 26.5 %
:HMM:PFM   113->228 PF00665 * rve 9.2e-25 30.2 116/120  
:HMM:PFM   83->119 PF00241 * Cofilin_ADF 0.00097 19.4 36/127  
:HMM:PFM   23->93 PF06334 * Orthopox_A47 0.00089 33.3 69/244  
:BLT:SWISS 4->276 INSK_ECOLI 3e-72 49.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55267.1 GT:GENE ACF55267.1 GT:PRODUCT IS3-Spn1, transposase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1462219..1463052) GB:FROM 1462219 GB:TO 1463052 GB:DIRECTION - GB:PRODUCT IS3-Spn1, transposase GB:NOTE identified by match to protein family HMM PF00665 GB:PROTEIN_ID ACF55267.1 GB:DB_XREF GI:194356819 LENGTH 277 SQ:AASEQ MTEFSLDILLKAIKLARSTYYYHLKQLDKPDKDQELKAEIQSIFIEHKGNYAYRRIYLELRNRGYLVNHKRVQGLMKVLNLQAKMRQKRKYSSHKGDVGKKAENLIQGQFEGSKTMEQCYTDVTEFTIPVSTQKLYLSPVLDGFNSEIIAYNLSTSPNLEQVQTMLEQAFTEKHYENTILYSDQGWQYQHDSYHQFLEGKGIQASMSRKGNSPDNGMMESFFGILKSEMFYGYEKSFQSLKQLEQAIVDYIDYYNNKRIKVKLKGLSPVQYRTKSFG GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 4->276|INSK_ECOLI|3e-72|49.3|268/283| RP:PDB:NREP 1 RP:PDB:REP 134->273|1b9dA|1e-14|12.0|125/143| RP:PFM:NREP 1 RP:PFM:REP 129->226|PF00665|8e-06|26.5|98/116|rve| HM:PFM:NREP 3 HM:PFM:REP 113->228|PF00665|9.2e-25|30.2|116/120|rve| HM:PFM:REP 83->119|PF00241|0.00097|19.4|36/127|Cofilin_ADF| HM:PFM:REP 23->93|PF06334|0.00089|33.3|69/244|Orthopox_A47| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00665|IPR001584| GO:PFM GO:0015074|"GO:DNA integration"|PF00665|IPR001584| RP:SCP:NREP 1 RP:SCP:REP 121->273|1b92A|4e-16|12.9|132/144|c.55.3.2| HM:SCP:REP 108->276|1c0mA2|2.4e-29|27.6|163/0|c.55.3.2|1/1|Ribonuclease H-like| OP:NHOMO 3735 OP:NHOMOORG 495 OP:PATTERN -------------------------------------------------------------------- 1-HI-MCE222J-D1G-11-1B--54G4HHE-C898-4A9--133--4-----1--2*----5---61-2-3---87-1-47-----1--8---2-1----3-614-31-------------------623--4-1------4---81----------------1-3----------------5-------164----56288BC786B-5992-941-39614-2--2-261222-6----1212-2-2--4-71-E8-N-6131647-851942OlN561CBi9-951D19867364832323535576272--MPC------7-41121111-8-R-11---139I-2--24-A421333--112---9-12BE----------A3312-3-1--22222222225-4-1----8-11--444---5--11-5-1-4-2---B2--CCCCCCCC-54B1A---------------------1-------------------W4--D855111-HF552232---9E-1-G-283B67D36129--57111-11--24-111-DK34-4-1312--8---------13-1-3----13------------------------E-2--2-J337-83--31PGO589-58A31nBA736----24--------1113226OQC62B76D-O965B581*6Q4ABB5CB3535--71-151--11-423-3--36*e*****--A9985A888-51---------7--143--FACD-15-134-1-----51--5BAI6832C11-41-341-6A9E---------42---65645O1115D3L9H7A456------9-----B4----------17981----227----2-D--3-11--1-J--------- -----------------------------------------------------------------------------------------------------------------------------------------------3--------------------------1-----------------3---------- ------------------------------------------------------------1-----------------------------------------------------------------------------------------1-----1------------------ STR:NPRED 169 STR:RPRED 61.0 SQ:SECSTR ############################################################################################################cccTTccccEEEEEEEEEccGGGTTTEEEEEEEETTTccEEEEEEccccHHHHHHHHHHHHHHccHccccEEEcccGGGGccHHHHHHHHHHTcEEccccHHHHHHHHHHHHHHHHGGGcccHHGGGccccHcccHHHHHHHHHHHHHccccccHHHHHHHHHccHHHH DISOP:02AL 1-1| PSIPRED cccccHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccccEEccHHHHHHHHHHHcccHHccccccccccccccccccccHHHHHHcccccccEEEEEEEEEEEEcccccEEEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHcc //