[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55271.1
DDBJ      :             capsular polysaccharide biosynthesis protein, putative
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  637/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:408 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->399 1mdzA PDBj 1e-47 33.5 %
:RPS:PDB   6->398 3bn1A PDBj 2e-53 31.9 %
:RPS:SCOP  17->396 1o61A  c.67.1.4 * 3e-88 26.4 %
:HMM:SCOP  2->402 1b9hA_ c.67.1.4 * 5.1e-93 37.0 %
:RPS:PFM   10->396 PF01041 * DegT_DnrJ_EryC1 7e-71 45.4 %
:HMM:PFM   11->396 PF01041 * DegT_DnrJ_EryC1 6.4e-90 35.4 359/363  
:BLT:SWISS 3->398 SPSC_BACSU 9e-70 38.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55271.1 GT:GENE ACF55271.1 GT:PRODUCT capsular polysaccharide biosynthesis protein, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1659974..1661200) GB:FROM 1659974 GB:TO 1661200 GB:DIRECTION - GB:PRODUCT capsular polysaccharide biosynthesis protein, putative GB:NOTE identified by match to protein family HMM PF01041 GB:PROTEIN_ID ACF55271.1 GB:DB_XREF GI:194356823 LENGTH 408 SQ:AASEQ MPNYNIPFSPPDITEAEIAEVADTLRSGWITTGPKTKELERRLSLYTQTPKTVCLNSATAALELILRVLEVGPGDEVIVPAMTYTASCSVITHVGATPVMVDIQADTFEMDYDLLEQAITEKTKVIIPVELAGIVCDYDRLFQVVEKKRDFFTASSKWQKAFNRIVIVSDSAHALGSTYKGQPSGSIADFTSFSFHAVKNFTTAEGGSATWKANPVIDDEEMYKEFQILSLHGQTKDALAKMQLGSWEYDIVTPAYXCNMTDIMASLGLVQLDRYPSLLQRRKDIVDRYDSGFAGSRIHPLAHKTETVESSRHLYITRVEGANLEERNLIIQELAKAGIASNVHYKPLPLLTAYKNLGFDMTNYPKAYAFFENEITLPLHTKLSDEEVDYIIETFKTVSEKVLTLSKK GT:EXON 1|1-408:0| BL:SWS:NREP 1 BL:SWS:REP 3->398|SPSC_BACSU|9e-70|38.1|373/389| BL:PDB:NREP 1 BL:PDB:REP 6->399|1mdzA|1e-47|33.5|361/364| RP:PDB:NREP 1 RP:PDB:REP 6->398|3bn1A|2e-53|31.9|360/367| RP:PFM:NREP 1 RP:PFM:REP 10->396|PF01041|7e-71|45.4|350/358|DegT_DnrJ_EryC1| HM:PFM:NREP 1 HM:PFM:REP 11->396|PF01041|6.4e-90|35.4|359/363|DegT_DnrJ_EryC1| RP:SCP:NREP 1 RP:SCP:REP 17->396|1o61A|3e-88|26.4|345/374|c.67.1.4| HM:SCP:REP 2->402|1b9hA_|5.1e-93|37.0|373/0|c.67.1.4|1/1|PLP-dependent transferases| OP:NHOMO 1668 OP:NHOMOORG 697 OP:PATTERN -----1--1-------1311111----2-1--222-1211--112-1414-11111-1-12---1-12 266-5---11----1--12-2---2-21222-----22112334-31-----223-----62316351-4---------231-113419433-711---43445334717--------------23233222344145575---2-4431444122222121214213364422222224122---1-222--3--1-122--111141--4443-1312-1211------22---------------2-12-------------1-----1--1--------------11111111111-----------------------1114633344446341-333221-3512-121332334311-1--21---121433211111115424322112322222222221-11221415321-----3425353133122112--222421111111121111912-----------------------------13-11-333233223222222211234444242243233124326223-1313211241-216211111111-21212315423435665348449538531222-25355531433453131111111441342241-112223113223251222222332143---1221------23232322332222322-32222222323223323322225876232333333332333322211222321233333323333--1-444442222311-31112-21----2--1-1111111311-212125521--222322211111111342111111112-13--23233223------63667779--------211-------------------------2233222222241 -------------1--------1212-------111--------------1---------------------------------------------------------2-------------------------------------------------1---121--------11---3F--2-----1---2---112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 408 STR:RPRED 100.0 SQ:SECSTR ccTcccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHTccEEEEEccHHHHHHHHHHHTTccTTcEEEEEccccTHHHHHHHHHTcEEEEEcccTTTccccHHHHGGGccTTEEEEccccGGGccccHHHHHHHHHHTcTTcEEHHHHHHTHTTcEEEEEcTTcTTcEETTEETTccccEEEEEccTTTcccccccEEEEEcTTTEEccHHHHHHHHHHHcTTccTTcTTccccccGGGccccccccccccHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHGGGGGGEEcccccTTcccccccEEEEEcTTccccHHHHHHHHHHTTcccEEccccGGGcGGGGGGccTccTcHHHHHHHHHEEEEcccTTccHHHHHHHHHHHHHHHHHTGGcccE DISOP:02AL 1-3,407-409| PSIPRED ccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHcccEEEEEEcccccccccHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHcccccHHHHHHHHHccEEEEEccccccccccccEEEEcHHHccccccccEEEEEcccccEEEEEcccccccHHHHHHHHHHHHcccccHHccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEccccccccccEEEEEEEEcccccccHHHHHHHHHHcccccEEEcccccccHHHHHccccccccHHHHHHHHccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHcc //