[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55272.1
DDBJ      :             dihydroorotate dehydrogenase A
Swiss-Prot:PYRD_STRPN   RecName: Full=Dihydroorotate dehydrogenase;         EC=1.3.3.1;AltName: Full=Dihydroorotate oxidase;AltName: Full=DHOdehase;         Short=DHODase;         Short=DHOD;

Homologs  Archaea  42/68 : Bacteria  384/915 : Eukaryota  91/199 : Viruses  0/175   --->[See Alignment]
c.1.4
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->308 1jueA PDBj e-105 61.1 %
:RPS:PDB   2->311 3c61A PDBj 8e-34 49.0 %
:RPS:SCOP  5->298 1gt8A2  c.1.4.1 * 2e-60 23.6 %
:HMM:SCOP  1->310 1uumA_ c.1.4.1 * 2.4e-68 30.4 %
:RPS:PFM   7->291 PF01180 * DHO_dh 4e-23 30.5 %
:HMM:PFM   5->292 PF01180 * DHO_dh 1.3e-82 31.0 284/293  
:BLT:SWISS 1->311 PYRD_STRPN e-174 100.0 %
:PROS 40->59|PS00911|DHODEHASE_1
:PROS 244->264|PS00912|DHODEHASE_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55272.1 GT:GENE ACF55272.1 GT:PRODUCT dihydroorotate dehydrogenase A GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 678037..678972 GB:FROM 678037 GB:TO 678972 GB:DIRECTION + GB:PRODUCT dihydroorotate dehydrogenase A GB:NOTE identified by match to protein family HMM PF01180; match to protein family HMM TIGR01037 GB:PROTEIN_ID ACF55272.1 GB:DB_XREF GI:194356824 LENGTH 311 SQ:AASEQ MVSTKTQIAGFEFDNCLMNAAGVACMTIEELEEVKNSAAGTFVTKTATLDFRQGNPEPRYQDVPLGSINSMGLPNNGLDYYLDYLLDLQEKESNRTFFLSLVGMSPEETHTILKKVQESDFRGLTELNLSCPNVPGKPQIAYDFETTDRILAEVFAYFTKPLGIKLPPYFDIVHFDQAAAIFNKYPLKFVNCVNSIGNGLYIEDESVVIRPKNGFGGIGGEYIKPTALANVHAFYQRLNPQIQIIGTGGVLTGRDAFEHILCGASMVQVGTTLHKEGVSAFDRITNELKAIMVEKGYESLEDFRGKLRYID GT:EXON 1|1-311:0| SW:ID PYRD_STRPN SW:DE RecName: Full=Dihydroorotate dehydrogenase; EC=1.3.3.1;AltName: Full=Dihydroorotate oxidase;AltName: Full=DHOdehase; Short=DHODase; Short=DHOD; SW:GN Name=pyrD; Synonyms=pyrDA; OrderedLocusNames=SP_0764; SW:KW Complete proteome; Cytoplasm; Flavoprotein; FMN; Oxidoreductase;Pyrimidine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->311|PYRD_STRPN|e-174|100.0|311/311| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006221|"GO:pyrimidine nucleotide biosynthetic process"|Pyrimidine biosynthesis| PROS 40->59|PS00911|DHODEHASE_1|PDOC00708| PROS 244->264|PS00912|DHODEHASE_2|PDOC00708| SEG 78->88|ldyyldylldl| BL:PDB:NREP 1 BL:PDB:REP 6->308|1jueA|e-105|61.1|303/311| RP:PDB:NREP 1 RP:PDB:REP 2->311|3c61A|8e-34|49.0|308/314| RP:PFM:NREP 1 RP:PFM:REP 7->291|PF01180|4e-23|30.5|282/290|DHO_dh| HM:PFM:NREP 1 HM:PFM:REP 5->292|PF01180|1.3e-82|31.0|284/293|DHO_dh| GO:PFM:NREP 3 GO:PFM GO:0004152|"GO:dihydroorotate dehydrogenase activity"|PF01180|IPR012135| GO:PFM GO:0006222|"GO:UMP biosynthetic process"|PF01180|IPR012135| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01180|IPR012135| RP:SCP:NREP 1 RP:SCP:REP 5->298|1gt8A2|2e-60|23.6|292/310|c.1.4.1| HM:SCP:REP 1->310|1uumA_|2.4e-68|30.4|303/0|c.1.4.1|1/1|FMN-linked oxidoreductases| OP:NHOMO 633 OP:NHOMOORG 517 OP:PATTERN 11212111-------1-------1-----1--11111111111111-111-11-11111111111--1 1111--------------------1------1--------111--------------------1--1---1-111111111111111111111111---------11-1----------------111-1111111-----1111-1--1-----------------1111--1--------------111-111111111111111111111111111111111111111-11--------------1----21-122111111111122111112221111111222222222222221111111111111222222222121111222222223212111111121111111111111111111111111112----------------------1111111-111---1-----1------111-111--1--11---1111111-------------1------1--------------------------1--------111111-----111-------111-----------1-1-1-----------11--------------11111111111111111211111-----111--------------------1---------1-----------------------------1--1--------1----1111111111-1111111111111111111------1-1-111111111-1-11--1----1-----------------1--------------------------11-------------11-11111--2-1-------------1----------------------------111111111---------1--------------------1-------122-111111-- 11------111-1---------------------------------11--11-1-11-1-------111--1---111111-----1---11-122----1--111-1212---11------1-12-2-271-23-11-----------111---2121--22121121371111--11V11-213112-11111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 311 STR:RPRED 100.0 SQ:SECSTR GccccEEETTEEEcccEEEcTTcccccHHHHHHHHHcccccEEEEEEccccccccccccEEEETTEEEEccccccccHHHHHHHHHHTcccTTTccEEEEEccccHHHHHHHHHHHHHHHHccEEEEEccccccTTcccGGGcHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHTcTTEEEEEEcEEEEcEETTTTEEcccGGGGEEEEEGGGGHHHHHHHHHHHHHHcTTTcEEEEEcccccHHHHHHHHHHTEEEEEEcHHHHHHcTTHHHHHHHHHHHHHHHHTcccGGGTTTcccccc DISOP:02AL 1-1,311-312| PSIPRED ccccEEEEccEEccccEEEccccccccHHHHHHHHHccccEEEEEEEccccccccccccEEEEcHHHHHHHccccccHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEEccccccccccHHcccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEccccccccccccccEEcccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEEEEHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHcccEEEcc //