[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55275.1
DDBJ      :             glutamate 5-kinase
Swiss-Prot:PROB_STRPI   RecName: Full=Glutamate 5-kinase;         EC=2.7.2.11;AltName: Full=Gamma-glutamyl kinase;         Short=GK;

Homologs  Archaea  8/68 : Bacteria  703/915 : Eukaryota  154/199 : Viruses  0/175   --->[See Alignment]
c.73.1
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->187 2j5tF PDBj 1e-27 34.6 %
:RPS:PDB   4->189 2akoA PDBj 2e-22 32.4 %
:RPS:SCOP  4->187 2akoA1  c.73.1.3 * 5e-22 30.6 %
:HMM:SCOP  3->183 1b7bA_ c.73.1.1 * 1.1e-45 38.7 %
:HMM:PFM   4->187 PF00696 * AA_kinase 1.7e-38 34.8 178/243  
:BLT:SWISS 1->187 PROB_STRPI 1e-71 96.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55275.1 GT:GENE ACF55275.1 GT:PRODUCT glutamate 5-kinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 833503..834090 GB:FROM 833503 GB:TO 834090 GB:DIRECTION + GB:PRODUCT glutamate 5-kinase GB:NOTE contains potential frameshift; identified by match to protein family HMM PF00696; match to protein family HMM TIGR01027 GB:PROTEIN_ID ACF55275.1 GB:DB_XREF GI:194356827 LENGTH 195 SQ:AASEQ MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALGFKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQALSVLLNRGAIPIINENDSVVIDEVKVGDNDTLSAQVAAMVQADLLVLLTDVDGLYTGNPNSESKSQTLGENRDHQS GT:EXON 1|1-195:0| SW:ID PROB_STRPI SW:DE RecName: Full=Glutamate 5-kinase; EC=2.7.2.11;AltName: Full=Gamma-glutamyl kinase; Short=GK; SW:GN Name=proB; OrderedLocusNames=SPH_1040; SW:KW Amino-acid biosynthesis; ATP-binding; Complete proteome; Cytoplasm;Kinase; Nucleotide-binding; Proline biosynthesis; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->187|PROB_STRPI|1e-71|96.8|187/369| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006561|"GO:proline biosynthetic process"|Proline biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 50->61|gaiaagfgalgf| SEG 81->92|llleeyttnlll| SEG 159->173|vqadllvlltdvdgl| BL:PDB:NREP 1 BL:PDB:REP 6->187|2j5tF|1e-27|34.6|182/354| RP:PDB:NREP 1 RP:PDB:REP 4->189|2akoA|2e-22|32.4|179/237| HM:PFM:NREP 1 HM:PFM:REP 4->187|PF00696|1.7e-38|34.8|178/243|AA_kinase| RP:SCP:NREP 1 RP:SCP:REP 4->187|2akoA1|5e-22|30.6|180/241|c.73.1.3| HM:SCP:REP 3->183|1b7bA_|1.1e-45|38.7|181/0|c.73.1.1|1/1|Carbamate kinase-like| OP:NHOMO 953 OP:NHOMOORG 865 OP:PATTERN ---------------------------111-1-----------------1111--------------- -1-1111111111111111-111111111111111111111111111-1--1111111--111111111111111111--11-11111111111-------1-111-111---------------11111111111111111111-11111111111111111111111111111111111111111111111211111111-11111111222211111111--11111111--------------------1---11-1---111111-1-11111111111111111111111111111111111111-1111111111112111-------1-11-221111111--1111111111-1-111111--1111-11111111111111111111111111111111-11111111121-1111111111121111211111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111-111111111111111111-1111111---1-------2111133111211112221122222122222111211---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---2-----111111111111111-11111111111111111111111111111111111111--------111111111111111--------------11-1111111---------1---------------------------11--1-111111 --11--1-31--111111-1111-11-111111111-11111111-1-11111111111111111111-1221111212211111111-11111111-11111311--2-2-3222-1111-1-1111-2A2--22-1-121111---111-11-111211----1-1111121-1212E2221112321--11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 194 STR:RPRED 99.5 SQ:SECSTR ccccEEEEEEcHHHHccccccccHHHHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHccccccccGHHHHHHHHHHHHHHHHHHHHHHHGGGTccEEEEEEcTGGGGcHHHHHHHHHHHHHHHHTTcEEEEEEcTTTccHHHHcTTTHHHHHHHHHHTTccEEEEEEcccccccccTTTcTTcccccEEEHHH# DISOP:02AL 1-1,190-196| PSIPRED cccEEEEEEEEcEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEccccEEEcccccccccHHHHHHHHHHHcccEEEEEEccccccccccccccccEEccccccccc //