[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55276.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   66->148 PF11457 * DUF3021 3e-17 53.0 %
:HMM:PFM   1->148 PF11457 * DUF3021 5.1e-39 38.1 134/137  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55276.1 GT:GENE ACF55276.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(163885..164343) GB:FROM 163885 GB:TO 164343 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55276.1 GB:DB_XREF GI:194356828 LENGTH 152 SQ:AASEQ MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVMDQHQVHGALVLLYCTLIWAAIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATLAGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK GT:EXON 1|1-152:0| TM:NTM 4 TM:REGION 8->30| TM:REGION 51->73| TM:REGION 82->104| TM:REGION 113->134| SEG 14->26|liglilsilfsli| RP:PFM:NREP 1 RP:PFM:REP 66->148|PF11457|3e-17|53.0|83/133|DUF3021| HM:PFM:NREP 1 HM:PFM:REP 1->148|PF11457|5.1e-39|38.1|134/137|DUF3021| OP:NHOMO 44 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1------1------------------111111111111111--11--1----------11------------------1--11111111111--------------11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,149-153| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //