[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55280.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  333/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:318 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   156->247 PF02653 * BPD_transp_2 8e-10 39.6 %
:HMM:PFM   12->296 PF02653 * BPD_transp_2 4.2e-42 29.0 262/267  
:BLT:SWISS 1->318 YUFQ_BACSU 4e-93 56.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55280.1 GT:GENE ACF55280.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 745235..746191 GB:FROM 745235 GB:TO 746191 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF02653 GB:PROTEIN_ID ACF55280.1 GB:DB_XREF GI:194356832 LENGTH 318 SQ:AASEQ MSIITLLPLLVSSMLIYSAPLIFTSIGGVFSERGGVVNVGLEGIMVMGAFSGVVFNLEFAEQFGAATPWLSLLVAGLVGSVFSIIHAAATVHFRADHVVSGTVLNLMAPALAVFLVKVLYNKGQTDNLSQTFGRFDFPVLANIPVIGDIFFKSTSLLGYLAIAFSFLAWFILFKTQFGLRLRSVGEHPQAADTLGINVYKMRYLGVIISGFLGGIGGAIYAQSISVNFSVTTIVGPGFIALAAMIFGKWNPIGAMLSSLFFGLSQSLAVIGSQLPFLQGVPAVYLQIAPYVLTILVLAAFFGKAVAPKADGINYIKSK GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 1->318|YUFQ_BACSU|4e-93|56.9|318/319| TM:NTM 9 TM:REGION 5->27| TM:REGION 38->60| TM:REGION 68->90| TM:REGION 99->121| TM:REGION 159->180| TM:REGION 202->222| TM:REGION 227->248| TM:REGION 252->274| TM:REGION 284->306| SEG 70->81|lsllvaglvgsv| SEG 256->267|lsslffglsqsl| RP:PFM:NREP 1 RP:PFM:REP 156->247|PF02653|8e-10|39.6|91/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 12->296|PF02653|4.2e-42|29.0|262/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 537 OP:NHOMOORG 358 OP:PATTERN 221-11------------2--11121111-1-----------------------1112121---2--- --1-1---------------------------------1-----21111111111-11--11311-1212--------1---1------------------------------------------1111111111122222---2--1-----12------------1111------------11-1122-111--1-111111111111---11111122222111111123--------------------11-1--1--1----------11211111111-111111111111111111111111111111122211111132222222221224---3222612111--1111-2-1111111112-12-------------222-----1--11111111112-------1-25--4225546555661----3314444223---------11---12-----------------------------------1-----------------41--------21111--11141--111-131-2-----1------------1-2-3-1132--1111----------111113-1---------------------------112-------1-------2------2--2----------------------------------------------------------------------------------------------------------------3-3---------------------2----2111--11-----11-11-----------------------------------------1------11111111112----1-1111111111111111---2721124212--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 122-133,316-319| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHccccccccc //