[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55284.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:150 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->130 1s4cB PDBj 3e-06 24.8 %
:RPS:SCOP  1->130 1jopA  b.82.2.7 * 5e-27 25.6 %
:HMM:SCOP  1->152 1jopA_ b.82.2.7 * 3.1e-42 39.7 %
:RPS:PFM   1->149 PF04074 * DUF386 3e-18 34.9 %
:HMM:PFM   1->149 PF04074 * DUF386 1.9e-53 43.0 149/153  
:BLT:SWISS 14->150 YHCH_ECOLI 2e-08 24.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55284.1 GT:GENE ACF55284.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1529694..1530146) GB:FROM 1529694 GB:TO 1530146 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF04074; match to protein family HMM TIGR00022 GB:PROTEIN_ID ACF55284.1 GB:DB_XREF GI:194356836 LENGTH 150 SQ:AASEQ MIFDDLKNITFYKGIHPNLDKAIDYLYQHRKDSFELGKYEIDGDKVFLVVQENVLNQVENNQFEHHKNYADLHLLIEGHEYSSYGSRIKDEAVAFDEASDIGFVHCHEHYPLLLGYHNFAIFFPGEPHQPNGYAGMEEKVRKYLFKILID GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 14->150|YHCH_ECOLI|2e-08|24.1|137/154| SEG 46->64|vflvvqenvlnqvennqfe| BL:PDB:NREP 1 BL:PDB:REP 1->130|1s4cB|3e-06|24.8|129/155| RP:PFM:NREP 1 RP:PFM:REP 1->149|PF04074|3e-18|34.9|149/153|DUF386| HM:PFM:NREP 1 HM:PFM:REP 1->149|PF04074|1.9e-53|43.0|149/153|DUF386| RP:SCP:NREP 1 RP:SCP:REP 1->130|1jopA|5e-27|25.6|121/140|b.82.2.7| HM:SCP:REP 1->152|1jopA_|3.1e-42|39.7|151/0|b.82.2.7|1/1|Clavaminate synthase-like| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1111111---11111111111-1------1-------------1------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------------------------------------------------------1---------------------------------------------------------------------------------------------1--1-----------------------------------------------------1----111----11---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 86.0 SQ:SECSTR cEEEETTcTTTTTTccHHHHHHHHHHTTccGGGcccEEEEcccccEEEEEccccccGGGccEEEccc#EEEEEEEEEccEEEEEEcccccGcccccTTTTcEEcccTTEEEEEEcTTEEEEEcTTccEEE#################### PSIPRED cEEccHHHccHHccccHHHHHHHHHHHHccHHHcccccEEcccccEEEEEEccccccccccccccccEEEEEEEEEEccEEEEEEcccccccccccccccEEEEccccEEEEEEccccEEEEcccHHHcccccccccccEEEEEEEEEcc //