[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55289.1
DDBJ      :             transcriptional repressor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  281/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.190.1
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->92 3edpA PDBj 5e-07 31.4 %
:BLT:PDB   147->236 2oggA PDBj 3e-22 52.8 %
:RPS:PDB   1->229 3eetA PDBj 1e-24 15.5 %
:RPS:SCOP  3->66 1e2xA1  a.4.5.6 * 3e-16 29.7 %
:RPS:SCOP  77->229 2ooiA1  d.190.1.2 * 2e-18 12.4 %
:HMM:SCOP  1->83 1v4rA1 a.4.5.6 * 3.7e-16 36.1 %
:HMM:SCOP  76->229 2fa1A1 d.190.1.2 * 1.8e-28 27.9 %
:RPS:PFM   5->66 PF00392 * GntR 1e-09 43.5 %
:HMM:PFM   89->227 PF07702 * UTRA 3.8e-29 29.5 139/141  
:HMM:PFM   3->66 PF00392 * GntR 7.4e-19 40.6 64/64  
:BLT:SWISS 1->236 TRER_BACSU 2e-43 38.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55289.1 GT:GENE ACF55289.1 GT:PRODUCT transcriptional repressor GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1703788..1704498 GB:FROM 1703788 GB:TO 1704498 GB:DIRECTION + GB:PRODUCT transcriptional repressor GB:NOTE identified by match to protein family HMM PF00392; match to protein family HMM PF07702; match to protein family HMM TIGR02404 GB:PROTEIN_ID ACF55289.1 GB:DB_XREF GI:194356841 LENGTH 236 SQ:AASEQ MKKYQQLFKQIQETIQNETYAVGDFLPSEHDLMEQYQVSRDTVRKALSLLQEEGLIKKIRGQGSQVVKEETVNFPVSNLTSYQELVKELGLRSKTNVVSLDKIIIDKKSSLITGFPEFRMVWKVVRQRVVDDLVSVLDTDYLDMELIPNLTRQIAEQSIYSYIENGLKLLIDYAQKEITIDHSSDRDKILMDIGKDPYVVSIKSKVYLQDGRQFQFTESRHKLEKFRFVDFAKRKK GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 1->236|TRER_BACSU|2e-43|38.6|236/238| SEG 99->112|sldkiiidkkssli| SEG 124->143|vvrqrvvddlvsvldtdyld| BL:PDB:NREP 2 BL:PDB:REP 4->92|3edpA|5e-07|31.4|86/217| BL:PDB:REP 147->236|2oggA|3e-22|52.8|89/143| RP:PDB:NREP 1 RP:PDB:REP 1->229|3eetA|1e-24|15.5|220/238| RP:PFM:NREP 1 RP:PFM:REP 5->66|PF00392|1e-09|43.5|62/64|GntR| HM:PFM:NREP 2 HM:PFM:REP 89->227|PF07702|3.8e-29|29.5|139/141|UTRA| HM:PFM:REP 3->66|PF00392|7.4e-19|40.6|64/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 2 RP:SCP:REP 3->66|1e2xA1|3e-16|29.7|64/73|a.4.5.6| RP:SCP:REP 77->229|2ooiA1|2e-18|12.4|153/157|d.190.1.2| HM:SCP:REP 1->83|1v4rA1|3.7e-16|36.1|83/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 76->229|2fa1A1|1.8e-28|27.9|154/0|d.190.1.2|1/1|Chorismate lyase-like| OP:NHOMO 503 OP:NHOMOORG 282 OP:PATTERN -------------------------------------------------------------------- -1-----------------------1----------------------------------------------------2---1-------------------------1-----------------------------------------------------------1-----------------------22333212331222113323323332223-223556565--1112222222111211--113311251112233112333321111122221112222222222222233332333333332433314441----22222222223-4--2333-1-1-1----22-2------111---3----11--------------------------------------------11-12211111-----------------------------------------------------------------------12222211-112222111111122----------------1----------1----------------------------------1--1-----------------------------------1-1-2--------------------------------------11-1--1111212-222-111221-222121111112-1-1----11-1-1-111-11111-11-1111--11111111-111----------------------1----------1-111------111-111-1----1-------------------------1-------------------1-----------------------------------1-------11---1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------5---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccEETccEcccccccccccccHHHHHHcccTTccEEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEETTEEEEEEEEEHHHHTTcTTcTTcTTccTTTTcHHHHTTccccEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEEETTEEEEEEEEEEETTTEEEEccccccc DISOP:02AL 236-237| PSIPRED ccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEccccHHHHHHHHHccHHHHHHHcccccEEEEEEEEEEcccHHHHHHHccccccHHHEEEEEEHcccEEEEEEEEcccHHHcccccHHHHcccHHHHHHHHHcccEEEEEEEEEEEEccHHHHHHcccccccEEEEEEEEEEcccccEEEEEEEEEcccEEEEEEEEEccc //