[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55293.1
DDBJ      :             radical SAM enzyme, Cfr family protein
Swiss-Prot:RLMN_STRP4   RecName: Full=Ribosomal RNA large subunit methyltransferase N;         EC=2.1.1.-;AltName: Full=23S rRNA m2A2503 methyltransferase;

Homologs  Archaea  1/68 : Bacteria  795/915 : Eukaryota  39/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:361 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   105->301 3cb8A PDBj 1e-05 21.9 %
:RPS:PDB   21->343 2a5hA PDBj 4e-24 13.6 %
:RPS:SCOP  101->315 1tv7A  c.1.28.3 * 2e-07 24.6 %
:HMM:SCOP  98->304 1tv8A_ c.1.28.3 * 4.6e-10 22.3 %
:RPS:PFM   110->277 PF04055 * Radical_SAM 5e-06 30.9 %
:HMM:PFM   105->274 PF04055 * Radical_SAM 2.2e-14 22.6 155/166  
:BLT:SWISS 1->361 RLMN_STRP4 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55293.1 GT:GENE ACF55293.1 GT:PRODUCT radical SAM enzyme, Cfr family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 681529..682614 GB:FROM 681529 GB:TO 682614 GB:DIRECTION + GB:PRODUCT radical SAM enzyme, Cfr family protein GB:NOTE identified by match to protein family HMM PF04055; match to protein family HMM TIGR00048 GB:PROTEIN_ID ACF55293.1 GB:DB_XREF GI:194356845 LENGTH 361 SQ:AASEQ MKPSIHSLAHQTMQEWVLEQGEKKFRADQIWEWLYRKRVQSFEEMTNLSKDLIAKLNDQFVVNPLKQRIVQESADGTVKYLFELPDGMLIETVLMCQHYGLSVCVTTQVGCNIGCTFCSSGLIKKQRDLNNGEIVAQIMLVQKYFDERGQDERVSHIVVMGIGEPFDNYNNVLNFFRTINDDKGMAIGARHITVSTSGLAHKIRDFADEGVQVNLAVSLHAPNNELRSSIMKINRAFPIEKLFAAIEYYIETTNRRVTFEYIMLNEVNDGVEQALELTELLKNIKKLSYVNLIPYNPVSEHDQYSRSPKERVLAFYDTLKKKGVNCVVRQEHGTDIDAACGQLRSNTMKRDRQKAVAAVNP GT:EXON 1|1-361:0| SW:ID RLMN_STRP4 SW:DE RecName: Full=Ribosomal RNA large subunit methyltransferase N; EC=2.1.1.-;AltName: Full=23S rRNA m2A2503 methyltransferase; SW:GN Name=rlmN; OrderedLocusNames=SPG_0699; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Iron; Iron-sulfur;Metal-binding; Methyltransferase; rRNA processing;S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->361|RLMN_STRP4|0.0|100.0|361/361| GO:SWS:NREP 7 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 105->301|3cb8A|1e-05|21.9|183/244| RP:PDB:NREP 1 RP:PDB:REP 21->343|2a5hA|4e-24|13.6|294/400| RP:PFM:NREP 1 RP:PFM:REP 110->277|PF04055|5e-06|30.9|152/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 105->274|PF04055|2.2e-14|22.6|155/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 101->315|1tv7A|2e-07|24.6|195/327|c.1.28.3| HM:SCP:REP 98->304|1tv8A_|4.6e-10|22.3|188/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 975 OP:NHOMOORG 835 OP:PATTERN -------------------------------------------------------------------1 111111111111111-111-11--1121121111111111111111111------11---1111111111111111111111121222111111111--11111111111--------------21111111111111111---11111111111111111111111111111111111111111111111112111111111111111211111111111111211111122111111111111111111111----------------------1111111111111111111111111111111111111121111111111111222222212111111111211111111111111111111111-11112111111111111111111121111111111111-1111111111111111111111111111111111111111111111111111111------------------------------111112111111111111111111111111111111111111122111111121111211121111111111122211211111111111111111111122223311111111111111111111111111111111111111111111111111111112111--1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-111111111111111112111111111-111111111111112122221111211112111111111111111111111111111111111111211111111111111--------111------------------1---1111111111111131 1111111-1---112----------------------------------------------------------------------------------------111--A1-----------------------------------------------------------------1434Q444334365-424412115 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 347 STR:RPRED 96.1 SQ:SECSTR #########HHHHHTTEEEEcHHHHcEETcHHHHHHTccccHHTTccccHHHHHHHcTTccccccHHHHTTccTTcTTcHHHHHHcccGGGGcccTTEcccccEEEEEEEcccccTTcTTTTTTTccccccHHHHHHHHHHHHHHTcTTHHTTccEEEEEEccTcHHHHHHHHHHHHTcTTccEEEEEccHHHHcGGGccHHHHHHGGGTccEEEEEccccGGGccHHHHHHHHHHHHHHHHHHHHHTTcEHTTccEEEEEEccTTTTcccHHHHHHHHHHHHTcTEEEEEEEcccccTTTcGGGcccHHHHHHHHHTTcTTcccGGGccEEEEEETTTTEEEHcHHHHHHHHHHH##### DISOP:02AL 345-362| PSIPRED cccccccccHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHccccccEEEEEEEcccccEEEEEEcccccEEEEEEEEEcccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHccHHHHHHHHHHHcccccccccccEEEEEcccccHHHHHHHHcccccEEEEEcccccHHHHHHHccccccccHHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccc //