[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55294.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->21 PF03047 * ComC 0.00035 53.8 13/32  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55294.1 GT:GENE ACF55294.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 828086..828307 GB:FROM 828086 GB:TO 828307 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55294.1 GB:DB_XREF GI:194356846 LENGTH 73 SQ:AASEQ MILMTKNINLTNEELELIQGGADPYGKEPNGYYPWKMEPVLTLLVHGFCPRDTDDLGYIGGGNHLCKGSAARF GT:EXON 1|1-73:0| HM:PFM:NREP 1 HM:PFM:REP 9->21|PF03047|0.00035|53.8|13/32|ComC| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,70-70,72-72| PSIPRED cEEEEccccccHHHHHHEEccccccccccccccccEEcEEEEEEEcccccccccccEEEcccccccccccccc //