[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55297.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  73/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->74 PF02677 * DUF208 5e-21 54.8 %
:HMM:PFM   1->77 PF02677 * DUF208 1e-28 46.8 77/176  
:BLT:SWISS 6->79 Y882_HAEIN 3e-07 35.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55297.1 GT:GENE ACF55297.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1737422..1737673) GB:FROM 1737422 GB:TO 1737673 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55297.1 GB:DB_XREF GI:194356849 LENGTH 83 SQ:AASEQ MAMDLGFDYFGSALTISPHKNSQTINSIGIDVQKIYTPHYLPNDFKKNQGYKRSVEMCEEYDIYRQCYCGCVYAAQAQNIDLV GT:EXON 1|1-83:0| BL:SWS:NREP 1 BL:SWS:REP 6->79|Y882_HAEIN|3e-07|35.1|74/100| RP:PFM:NREP 1 RP:PFM:REP 2->74|PF02677|5e-21|54.8|73/176|DUF208| HM:PFM:NREP 1 HM:PFM:REP 1->77|PF02677|1e-28|46.8|77/176|DUF208| OP:NHOMO 73 OP:NHOMOORG 73 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------11--------------------------------------------111111111111111111-------------------1----11111111111------1-1----1111111111111-11---111----111-1--1------11-------11-11-----------------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------1---------------------------1--1----11--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHccccHHHHHHcccccccHHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccc //