[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55304.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->57 PF10086 * DUF2324 1e-04 50.0 %
:HMM:PFM   12->61 PF10086 * DUF2324 2.1e-12 31.2 48/223  
:BLT:SWISS 14->57 YHFC_BACSU 1e-05 50.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55304.1 GT:GENE ACF55304.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1299956..1300147) GB:FROM 1299956 GB:TO 1300147 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF55304.1 GB:DB_XREF GI:194356856 LENGTH 63 SQ:AASEQ MTIHIIITMLLLLAFLIGSIWFAKKKYQINLAVLGLGAVAFFVSSQILEKLVHILILHPQKRR GT:EXON 1|1-63:0| BL:SWS:NREP 1 BL:SWS:REP 14->57|YHFC_BACSU|1e-05|50.0|44/100| TM:NTM 2 TM:REGION 2->23| TM:REGION 33->55| SEG 1->13|mtihiiitmllll| RP:PFM:NREP 1 RP:PFM:REP 22->57|PF10086|1e-04|50.0|36/217|DUF2324| HM:PFM:NREP 1 HM:PFM:REP 12->61|PF10086|2.1e-12|31.2|48/223|DUF2324| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 61-64| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //