[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55307.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  98/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   39->260 PF06182 * DUF990 5e-26 33.0 %
:HMM:PFM   31->261 PF06182 * DUF990 1.8e-80 37.2 231/233  
:BLT:SWISS 133->209 COX1_DICCI 7e-04 35.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55307.1 GT:GENE ACF55307.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 565125..565910 GB:FROM 565125 GB:TO 565910 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF06182 GB:PROTEIN_ID ACF55307.1 GB:DB_XREF GI:194356859 LENGTH 261 SQ:AASEQ MKKYQRMHLIFIRQYIKQIMEYKVDFVVGVLGVFLAQGLNLLFLNVIFQHIPFLEGWTFQEIAFIYGFSLIPKGMDHLFFDNLWALGQRLVRXGEFDKYLTRPINPLFHILVETFQIDALGELLVGGILLGTTVTSIVWTLPKFLLFLVCIPFATLIYTSLKIATASIAFWTKQSGAMIYIFYMFNDFAKYPISIYNSLLRWLISFIVPFAFTAYYPASYFLQEKDVFFNVGGLMLISLVFFVISLKLWDKGLDSYESAGS GT:EXON 1|1-261:0| BL:SWS:NREP 1 BL:SWS:REP 133->209|COX1_DICCI|7e-04|35.1|77/773| TM:NTM 5 TM:REGION 26->48| TM:REGION 118->140| TM:REGION 147->169| TM:REGION 184->206| TM:REGION 228->250| SEG 26->35|fvvgvlgvfl| SEG 120->131|lgellvggillg| RP:PFM:NREP 1 RP:PFM:REP 39->260|PF06182|5e-26|33.0|221/234|DUF990| HM:PFM:NREP 1 HM:PFM:REP 31->261|PF06182|1.8e-80|37.2|231/233|DUF990| OP:NHOMO 114 OP:NHOMOORG 98 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1--------------------1----1-------------------------------------------------------------------111----1---1--------------------1---------------1--3---1-111111111111111------111222---1------24------------------------11---1----------------11111-12--111211211111111111111111111111111----------------21---1113-1---------1----------1-1------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1--1--------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1--------------------------1-1-------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,258-262| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccHHHHHHccccHHHHHHHHHccHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //