[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55312.1
DDBJ      :             acetyltransferase, GNAT family protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  264/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->171 2i79A PDBj 1e-93 99.4 %
:RPS:PDB   1->172 3eg7B PDBj 2e-22 18.2 %
:RPS:SCOP  7->169 1yr0A1  d.108.1.1 * 1e-22 19.1 %
:HMM:SCOP  4->172 1yreA1 d.108.1.1 * 3.6e-31 28.1 %
:RPS:PFM   32->72 PF06835 * DUF1239 4e-04 50.0 %
:RPS:PFM   98->145 PF00583 * Acetyltransf_1 1e-06 44.7 %
:HMM:PFM   66->144 PF00583 * Acetyltransf_1 4.6e-18 32.9 76/83  
:BLT:SWISS 62->170 YHHY_ECOLI 6e-15 34.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55312.1 GT:GENE ACF55312.1 GT:PRODUCT acetyltransferase, GNAT family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1764912..1765430) GB:FROM 1764912 GB:TO 1765430 GB:DIRECTION - GB:PRODUCT acetyltransferase, GNAT family protein GB:NOTE identified by match to protein family HMM PF00583 GB:PROTEIN_ID ACF55312.1 GB:DB_XREF GI:194356864 LENGTH 172 SQ:AASEQ MEYELLIREAEPKDAAELVAFLNRVSLETDXTSLDGDGILLTSEEMEIFLNKQASSDNQITLLAFLNGKIAGIVNITADQRKRVRHIGDLFIVIGKRYWNNGLGSLLLEEAIEWAQASGILRRLQLTVQTRNQAAVHLYQKHGFVIEGSQERGAYIEEGKFIDVYLMGKLID GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 62->170|YHHY_ECOLI|6e-15|34.3|108/162| BL:PDB:NREP 1 BL:PDB:REP 1->171|2i79A|1e-93|99.4|171/171| RP:PDB:NREP 1 RP:PDB:REP 1->172|3eg7B|2e-22|18.2|165/172| RP:PFM:NREP 2 RP:PFM:REP 32->72|PF06835|4e-04|50.0|40/170|DUF1239| RP:PFM:REP 98->145|PF00583|1e-06|44.7|47/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 66->144|PF00583|4.6e-18|32.9|76/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 7->169|1yr0A1|1e-22|19.1|157/163|d.108.1.1| HM:SCP:REP 4->172|1yreA1|3.6e-31|28.1|160/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 367 OP:NHOMOORG 271 OP:PATTERN ------------------------1--1----------------------11---------111---- ---------------------------------------------------------------------------------------------------------1--------------1111--------------------1------------------------------------------------144444434223455311222-3351213-1-1111-12--11111111111111-11111-1----1---1111--1-2--122211111111--1111111111111111111111111111111111-2232222444414212---12------1-1--22------1-111--1-------------1-----1-1--1-----------1-------1--1---1111-11--------------------------------------------------------------------------------------111-------1-1---------------------------2-------------------------------------------------------------------------22---------111111-1----1-1-111-------------1111-1-111-111111-1111111111111111111111---111-11111111111111111-1111--1--------------------------------------------------------1111-221------122----------1111-----11211-----------------1----------------1--------------------------2-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 100.0 SQ:SECSTR HHHTcEEEEccGGGHHHHHHHTTTTccEETcGGETTEEEccHHHHHHHHHHHTTccccEEEEEEcTTccEEEEEEEEEEETTTTEEEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTccccEEEEEEETTcHHHHHHHHHTTcEEEEHEEEEEEEETTEEEEEEEEEEHHH DISOP:02AL 1-1| PSIPRED cccEEEEEEccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEEEEEcccccEEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHcccEEEEEEEEEcccHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEEEEEEcc //