[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55321.1
DDBJ      :             ABC transporter,  binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:430 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->428 2w7yA PDBj 0.0 98.9 %
:RPS:PDB   56->429 1a7lA PDBj 8e-25 15.3 %
:RPS:SCOP  56->429 1a7lA  c.94.1.1 * 8e-24 16.4 %
:HMM:SCOP  22->429 1y3nA1 c.94.1.1 * 7.6e-50 24.6 %
:RPS:PFM   71->299 PF01547 * SBP_bac_1 3e-09 30.5 %
:HMM:PFM   58->339 PF01547 * SBP_bac_1 1.3e-23 23.1 268/314  
:BLT:SWISS 4->386 YURO_BACSU 4e-12 23.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55321.1 GT:GENE ACF55321.1 GT:PRODUCT ABC transporter, binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1998951..2000243) GB:FROM 1998951 GB:TO 2000243 GB:DIRECTION - GB:PRODUCT ABC transporter, binding protein GB:NOTE identified by match to protein family HMM PF01547 GB:PROTEIN_ID ACF55321.1 GB:DB_XREF GI:194356873 LENGTH 430 SQ:AASEQ MNKKSLLKCAVIGLVATFGLAACGTSKDASGGSSSGKEVLEFYHGYHHSEDEWPVAKTMRDLYDKFAEEHKDSGVEFKPTPVNGDLKDIMNNKVASGEFPDVIDLAGNAVSLAAIEQKLVLDLKPYIDSNKLEKNVGLNYKQNQKDGKIYTVHEQLFTMGLWYNKDIFAKAGAKTPDQWNTWDDFTQAMASIRKQDGVYAFGAGEPSIRLFNTVLGTTENGRKLLDKPLTKEGIESKEFADALKMVMKEIQANGSKNAGGDANAYSKDFQEGKSAVFFNGVWASGEMSKNPSLAPGIYPAGVAISSSGGGITISSKMSEAKQKLALEFLKYMTSDDVQKVIFEKVGANPSNENVNVKELSEKSSEATTKILGQAITQVKNAKAVVPTVSDVWGGDVQTAIINALTESAAENVDVDQKVKSTQDVLKSLIG GT:EXON 1|1-430:0| BL:SWS:NREP 1 BL:SWS:REP 4->386|YURO_BACSU|4e-12|23.2|358/422| TM:NTM 1 TM:REGION 5->25| SEG 30->36|sggsssg| SEG 304->315|isssgggitiss| BL:PDB:NREP 1 BL:PDB:REP 38->428|2w7yA|0.0|98.9|380/380| RP:PDB:NREP 1 RP:PDB:REP 56->429|1a7lA|8e-25|15.3|353/380| RP:PFM:NREP 1 RP:PFM:REP 71->299|PF01547|3e-09|30.5|213/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 58->339|PF01547|1.3e-23|23.1|268/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 56->429|1a7lA|8e-24|16.4|353/380|c.94.1.1| HM:SCP:REP 22->429|1y3nA1|7.6e-50|24.6|390/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 94 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- ----1-----------------------------------------1-----111-------1---111-------------------------------------------------------------------111---------------------------------------------1---21--1-------11--1---1-----1-----2----32222255--------------------11------1----------------1-1--------12223231112---------------1---111-----2----------3----211-------1--------1-----1---1------------------------------------------------------1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 428 STR:RPRED 99.5 SQ:SECSTR ##EEEEccccccccHHHHcHccTTccEEEEccccccTTEEEEEEcEccTTccHHHHHHHHHHHHHHHHHHHHHcccEEEEccTTTHHHHHHHHGGGTccccEEEEEGGGHHHHHHHTTccccccccHHHHTccTccHHHHGGGEETTEEccEEEEEEccEEEEETTTccccccccTTHHHHHHHHHTTHHHHTccccccccccHHHHHHHHHHTTcEEEcccccccccEccEEcccHHHHHHHHHHHHHHHTTcccTTccHHHHHHHHHHTTcccEEEEcGGGHHHHTccEEEEcccccTTcccccEEEEEEEEEcTTcTTHHHHHHHHHHTTccHHHHHHHHHHccccEEccHHHHHHHHHHHHHTTcHHHHHHHHHHHHcEEccccTHHTHHHHHHHHHHHHHHHHTTcccHHHHHHHHHccHHHHcT DISOP:02AL 1-5,24-39| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHcccccccHHHHcccccccHHHHHHHHcccccEEEEEEEEEccEEEEEEHHHHHHcccccccccccHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHcccccEEcccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHcccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcc //