[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55326.1
DDBJ      :             glyoxalase family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  135/915 : Eukaryota  45/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->120 1ecsA PDBj 2e-12 13.2 %
:RPS:SCOP  1->120 1ecsA  d.32.1.2 * 1e-12 13.2 %
:HMM:SCOP  1->121 1q0oA2 d.32.1.3 * 4.6e-16 29.5 %
:HMM:PFM   2->116 PF00903 * Glyoxalase 1.2e-08 28.8 111/128  
:BLT:SWISS 35->63 SYL_SYNPW 8e-04 48.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55326.1 GT:GENE ACF55326.1 GT:PRODUCT glyoxalase family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1416665..1417030) GB:FROM 1416665 GB:TO 1417030 GB:DIRECTION - GB:PRODUCT glyoxalase family protein GB:NOTE identified by match to protein family HMM PF00903 GB:PROTEIN_ID ACF55326.1 GB:DB_XREF GI:194356878 LENGTH 121 SQ:AASEQ MIDHFEIKVKDLQISEGFYRSFLAPLDYKMTFKTSSLISFLSPNSPHPGGDFWLTQGTQDPVHFAFLAENKEEVQACYEAGLEAGGRDNGAPGYRSEHPIYYAAFMIDLDGNNIEVVCHKE GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 35->63|SYL_SYNPW|8e-04|48.3|29/100| RP:PDB:NREP 1 RP:PDB:REP 1->120|1ecsA|2e-12|13.2|114/120| HM:PFM:NREP 1 HM:PFM:REP 2->116|PF00903|1.2e-08|28.8|111/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->120|1ecsA|1e-12|13.2|114/120|d.32.1.2| HM:SCP:REP 1->121|1q0oA2|4.6e-16|29.5|112/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 269 OP:NHOMOORG 180 OP:PATTERN -------------------------------------------------------------------- ---------------11----1---1------1111-------1----------------11---------1---311--1-----------------------------------------------------------------1-------------------1--------------------------------------------------------------------------------------------------------------11--------11-1111111111-------------1--------------------------------------------------------------1111------1223---1--1-22222222222---------132-4--122122132121----12112-----------------11---------------------------------------22232221----11--1111-13-11-22---1---1111-1---11----1---------------1-------------------------1--3-----------------------------12-------------------------------------------11-1---------------1---------------23211------------------------------------------------------------------------------------1---------1---------------------------1--312221211222--------------------------------------------------------------- ---------------111222232-2222222211-2222222222--111111-2111---------------------------------11-2----------------------------------------------------------------------------------------1---21--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 100.0 SQ:SECSTR cccccEEEEccHHHHHHHHHTTTcETTcEEEEEcccEEEEEETTEEEEEEEcTTccGGGcccEEEEHHHHHHHHHHTTcccccccccEEEEEEEEEcTTccEEEEEEcTTccEEEEEEccc DISOP:02AL 121-122| PSIPRED cEEEEEEEcccHHHHHHHHHHHHHHcccEEEEEcccEEEEEEcccccccccEEEEcccccccEEEEEEccHHHHHHHHHHHHHcccEEccccccccccccEEEEEEEcccccEEEEEEccc //