[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55330.1
DDBJ      :             glycosyl transferase, group 2 family protein
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  635/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->102 2z87B PDBj 5e-16 31.6 %
:RPS:PDB   7->321 2bo7A PDBj 1e-24 9.5 %
:RPS:SCOP  5->232 1h7lA  c.68.1.1 * 8e-25 15.7 %
:HMM:SCOP  1->287 1xhbA2 c.68.1.17 * 1.6e-50 24.0 %
:RPS:PFM   7->115 PF00535 * Glycos_transf_2 1e-24 42.2 %
:HMM:PFM   7->136 PF00535 * Glycos_transf_2 2.1e-41 38.5 130/169  
:BLT:SWISS 5->219 EPSJ_BACSU 1e-29 32.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55330.1 GT:GENE ACF55330.1 GT:PRODUCT glycosyl transferase, group 2 family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1272244..1273230) GB:FROM 1272244 GB:TO 1273230 GB:DIRECTION - GB:PRODUCT glycosyl transferase, group 2 family protein GB:NOTE identified by match to protein family HMM PF00535 GB:PROTEIN_ID ACF55330.1 GB:DB_XREF GI:194356882 LENGTH 328 SQ:AASEQ METALISVIVPVYNVAQYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDARVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPEMIQSLYEQLVQEDADVSSCGVMNVYANDESPQSANQDDYFVCDSQTFLKEYLIGEKIPGTICNKLIKRQIATDLSFPKGLIYEDAYYHFDLIKLAKKYVVNTKPYYYYFHRGDSITTKPYAEKDLAYIDIYQKFYNEVVKNYPDLKEVAFFRLAYAHFFILDKMLLDDQYKQFEAYSQIHRFLKGHAFAISRNPIFRKGRRISALALFINISLYRFLLLKNIEKSKKLH GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 5->219|EPSJ_BACSU|1e-29|32.1|215/344| BL:PDB:NREP 1 BL:PDB:REP 5->102|2z87B|5e-16|31.6|98/591| RP:PDB:NREP 1 RP:PDB:REP 7->321|2bo7A|1e-24|9.5|305/375| RP:PFM:NREP 1 RP:PFM:REP 7->115|PF00535|1e-24|42.2|109/148|Glycos_transf_2| HM:PFM:NREP 1 HM:PFM:REP 7->136|PF00535|2.1e-41|38.5|130/169|Glycos_transf_2| RP:SCP:NREP 1 RP:SCP:REP 5->232|1h7lA|8e-25|15.7|217/239|c.68.1.1| HM:SCP:REP 1->287|1xhbA2|1.6e-50|24.0|283/0|c.68.1.17|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 1863 OP:NHOMOORG 696 OP:PATTERN 11------1222-1----1-11-1322-----AB-1--1-2122313-13146-2244433---1-12 12513--111------111-1-----11111--1-1-3--1--125222--11-11-2--231--1-A9A351117532174-13123CIGC-D23---D2875546A-7--------------23231335333442225-----46CL996----2--1131345CFB7-12--11-2-11---1-4213-7434344532355444363346534-2215-121242133223121222222222411254112344122223--2424313-449333-11111142272446271-------------544435444--1-7411112222442322-5112-31-256112122-112---1---121121--1-----61221--1-11-1--11--11111-1122151-431-433145345544-123----11122--11111111-4414123------------2222222222222-------32113331-1131---------4-------------11-1-2212-11--1-1123-121-2-123313-11-2-525317725265254A8646D5522225-6511213744565151111111-1133--12113521411-1-2--1321-1--21-21---2112------33---131223143222-1213412321221221221213-425611111111111111115-22--12--333333233323--22---------2251-22121111212---322222--1--53443415331--12-2217222222221---2-----1-2---121111111----1-64325566111111115--------1--1-1------2------11-21-11-1257 ----31----------------------------------------------------------------------1--1---------------------------1--1--1-1--------2--1-121---3-------------------1--32-1------------------111---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 321 STR:RPRED 97.9 SQ:SECSTR cccccEEEEEEEccccHHHHHHHHHHHHHcTcTccEEEEEEccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEccTTcccccHHHHHHHHHHHHHTccEEEEEccccTTccHHHHHTHHHHHHHHcTTccGGGcccTTcccEEEEHHHHHHHHHcHHHHTcccTTHHHHHHHHHHHTTccEEEEEcTTccccccHHHHHHHHHHHHHHHTTccccccccEEEcccccccHHHHTcccccHHHHHHHTTHHHTcccHHccccHHHHHHGGGccHHHHHHHHHTTTccccTTccHHHHHHHHHHHHc####### DISOP:02AL 1-1,328-329| PSIPRED cccccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEEEEcccccccccccccccccccHHHHHHHHHcccccccccHHHEEEHHHHHHcccccccEEcHHHHHHHHHHHcccEEEEcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcHHHcHHHHHHHHHHHHccHHHHHHHHHHHccccccc //