[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55339.1
DDBJ      :             type I restriction-modification system, S subunit, putative
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.287.1
:373 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->265 1yf2A PDBj 2e-04 25.0 %
:RPS:SCOP  2->179 1ydxA2  d.287.1.2 * 5e-17 13.7 %
:RPS:SCOP  192->304 1yf2A1  d.287.1.2 * 5e-08 17.2 %
:HMM:SCOP  2->178 1yf2A1 d.287.1.2 * 4.8e-23 25.4 %
:HMM:SCOP  189->372 1yf2A1 d.287.1.2 * 3e-30 26.8 %
:RPS:PFM   4->160 PF01420 * Methylase_S 3e-08 25.3 %
:RPS:PFM   231->303 PF01420 * Methylase_S 1e-05 37.0 %
:HMM:PFM   2->154 PF01420 * Methylase_S 2.9e-19 22.8 149/167  
:HMM:PFM   201->359 PF01420 * Methylase_S 1e-17 29.8 141/167  
:BLT:SWISS 3->176 T1SB_ECOLX 5e-33 40.5 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55339.1 GT:GENE ACF55339.1 GT:PRODUCT type I restriction-modification system, S subunit, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 786735..787856 GB:FROM 786735 GB:TO 787856 GB:DIRECTION + GB:PRODUCT type I restriction-modification system, S subunit, putative GB:NOTE identified by match to protein family HMM PF01420 GB:PROTEIN_ID ACF55339.1 GB:DB_XREF GI:194356891 LENGTH 373 SQ:AASEQ MKKVKLGEVCEILSGYAFKSSQFNDNKIGLPLIRIRDVERGFSDTYFEGTYPEEYLIKNGDLLITMDGSFILKKWEGDLALLNQRVCKIKITDKSVDEGYISWLIPKFLKEIEDKTPFVTVKHLSVAKIKDISFVLPNKLEQKLIAKKLNTISQIYDFRKIQSEKFNELVKSRFNEMFGENKIFESIDNLFDXIDGDRGKNYPKSDELFSEEYCLFLNTKNVTKNGFSFDTKQFITKTKDKLLRKGKLERYDIVLTTRGTVGNVAYYDELIKYKHLRINSGMVILRPKTPNLNQKFIIHVLRNNNYSRVISGSAQPQLPITKLKKILLPLPPLALQNEFADFVVQVDKSQLAIQKSLEELETLKKSLMQEYFG GT:EXON 1|1-373:0| BL:SWS:NREP 1 BL:SWS:REP 3->176|T1SB_ECOLX|5e-33|40.5|173/474| COIL:NAA 37 COIL:NSEG 1 COIL:REGION 334->370| SEG 316->336|pqlpitklkkillplpplalq| SEG 355->367|ksleeletlkksl| BL:PDB:NREP 1 BL:PDB:REP 4->265|1yf2A|2e-04|25.0|256/425| RP:PFM:NREP 2 RP:PFM:REP 4->160|PF01420|3e-08|25.3|154/167|Methylase_S| RP:PFM:REP 231->303|PF01420|1e-05|37.0|63/167|Methylase_S| HM:PFM:NREP 2 HM:PFM:REP 2->154|PF01420|2.9e-19|22.8|149/167|Methylase_S| HM:PFM:REP 201->359|PF01420|1e-17|29.8|141/167|Methylase_S| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF01420|IPR000055| GO:PFM GO:0006304|"GO:DNA modification"|PF01420|IPR000055| GO:PFM GO:0003677|"GO:DNA binding"|PF01420|IPR000055| GO:PFM GO:0006304|"GO:DNA modification"|PF01420|IPR000055| RP:SCP:NREP 2 RP:SCP:REP 2->179|1ydxA2|5e-17|13.7|168/181|d.287.1.2| RP:SCP:REP 192->304|1yf2A1|5e-08|17.2|108/220|d.287.1.2| HM:SCP:REP 2->178|1yf2A1|4.8e-23|25.4|177/0|d.287.1.2|1/2|DNA methylase specificity domain| HM:SCP:REP 189->372|1yf2A1|3e-30|26.8|179/0|d.287.1.2|2/2|DNA methylase specificity domain| OP:NHOMO 59 OP:NHOMOORG 50 OP:PATTERN ----1------------------------------------1-1------1----------------- ---------------------------------1-1------------------------------------------------------------------------1--------------------1--------------------------------------1--------------------------------------------------1---------------------------------------------------------------------2--22221232----------------------------111-1--11----------------1-------------------1-1-------------------------------------------------------------------------11111111---1-------------------------------------------------------------------1--------------------------1--------------------------1-------------1---------------------------------------------------------------------1----------1-----------------------------1-------1----------1----------------------------------------------1--1-----------------1----------------------------1------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 68.6 SQ:SECSTR ###EEHHHHEEEEEcccccTTcGGGTTTcEEEEcHHHHHT##cccEEcccEcHHccccTTcEEEEccccTTcEEEEccccEEcccEEEEEEcTTTccHHHHHHHHHHTHHHHHccccccccccccHHHHHTcEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTccEETTcEEEE#HHHHEEEEEcTTcGGGTTTccE###EEEcHHHHHTTTTccEEcccccEEcHHHHHHTTcccccTTcEEEEccccTTcEE############################################################################################################ PSIPRED cEEEEEEEEEEEEEcccccccccccccccEEEEEEEcccccccccccccccccEEEEccccEEEEccccEEEEEEcccccEEEccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccccccccccccccccEEEEEEccEEcccEEcccccccccHHHHHHHHcccccccEEEEEEccccEEEEEcccccccEEEEEccEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //