[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55343.1
DDBJ      :             polysaccharide biosynthesis protein, putative
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  174/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:540 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->266 PF01943 * Polysacc_synt 5e-17 34.9 %
:RPS:PFM   305->386 PF03023 * MVIN 8e-05 34.1 %
:HMM:PFM   12->318 PF01943 * Polysacc_synt 3.9e-31 23.6 271/273  
:HMM:PFM   295->411 PF01554 * MatE 4.8e-06 15.4 117/162  
:HMM:PFM   449->518 PF06946 * Phage_holin_5 0.00075 30.0 70/93  
:BLT:SWISS 13->458 SP5B_BACSU 2e-15 24.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55343.1 GT:GENE ACF55343.1 GT:PRODUCT polysaccharide biosynthesis protein, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1405209..1406831) GB:FROM 1405209 GB:TO 1406831 GB:DIRECTION - GB:PRODUCT polysaccharide biosynthesis protein, putative GB:NOTE identified by match to protein family HMM PF01943 GB:PROTEIN_ID ACF55343.1 GB:DB_XREF GI:194356895 LENGTH 540 SQ:AASEQ MSHENNHQQAQMLRGTAWLTASNFISRLLGAVYIIPWYIWMGAYAAKANGLFTMGYNIYAWFLLVSTAGIPVAVAKQVAKYNTMREEEHSFALIRSFLGFMTGLGLVFALVLXVFAPWLADLSGVGKDLIPIMQSLAWGVLIFPSMSVIRGFFQGMNNLKPYAMSQIAEQVIRVIWMLLATFIIMKLGSGDYLAAVTQSTFAAFVGMVASFAVLIYFLAQEGSLKRVFETGDKINSKRLLVDTIKEAIPFILTGSAIQLFQILDQLTFINSMSWFTNYSNEDLVVMFSYFSANPNKITMILISVGVSIGSVGLPLLTENYVKGDLKAASRLVQDSLTLLFMFLLPATVGVVMVGEPLYTVFYGKPDSLALGLFVFAVLQSIILGLYMVLSPMLQAMFRNRKAVLYFIYGSIAKLVLQLPTIALFHSYGPLISTTIALIIPNVLMYRDICKVTGVKRKVILKRTILISLLTLVMFLLIGTIQWLLGFFFQPSGRLWSFFYVALVGAMGGGLYMVMSXRTYLLDKVIGKAQADRLRAKFKLS GT:EXON 1|1-540:0| BL:SWS:NREP 1 BL:SWS:REP 13->458|SP5B_BACSU|2e-15|24.4|418/518| TM:NTM 14 TM:REGION 21->43| TM:REGION 58->80| TM:REGION 94->116| TM:REGION 128->150| TM:REGION 168->190| TM:REGION 197->219| TM:REGION 246->268| TM:REGION 297->319| TM:REGION 334->356| TM:REGION 371->393| TM:REGION 402->424| TM:REGION 426->448| TM:REGION 463->485| TM:REGION 492->514| SEG 103->116|glglvfalvlxvfa| RP:PFM:NREP 2 RP:PFM:REP 13->266|PF01943|5e-17|34.9|229/274|Polysacc_synt| RP:PFM:REP 305->386|PF03023|8e-05|34.1|82/450|MVIN| HM:PFM:NREP 3 HM:PFM:REP 12->318|PF01943|3.9e-31|23.6|271/273|Polysacc_synt| HM:PFM:REP 295->411|PF01554|4.8e-06|15.4|117/162|MatE| HM:PFM:REP 449->518|PF06946|0.00075|30.0|70/93|Phage_holin_5| GO:PFM:NREP 2 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF01943|IPR002797| GO:PFM GO:0016020|"GO:membrane"|PF01943|IPR002797| OP:NHOMO 335 OP:NHOMOORG 176 OP:PATTERN --------------------------------11---------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------133555555556555535323322555112322233333323222222222222222122123231121112122111222112211111111111111111111111111111111111111111111111-1222222221222311221333111---1111112-1111--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15,223-236,540-541| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccc //