[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55352.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.248.1
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->77 2fi0A PDBj 5e-40 98.7 %
:HMM:SCOP  1->77 2fi0A1 a.248.1.1 * 7.9e-20 45.5 %
:HMM:PFM   5->63 PF08984 * DUF1858 1.7e-26 54.2 59/59  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55352.1 GT:GENE ACF55352.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 493755..493988 GB:FROM 493755 GB:TO 493988 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF08984 GB:PROTEIN_ID ACF55352.1 GB:DB_XREF GI:194356904 LENGTH 77 SQ:AASEQ MDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPIMRNTVGRKVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD GT:EXON 1|1-77:0| BL:PDB:NREP 1 BL:PDB:REP 1->77|2fi0A|5e-40|98.7|77/79| HM:PFM:NREP 1 HM:PFM:REP 5->63|PF08984|1.7e-26|54.2|59/59|DUF1858| HM:SCP:REP 1->77|2fi0A1|7.9e-20|45.5|77/0|a.248.1.1|1/1|SP0561-like| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------11111111111111-------------11111-111---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 100.0 SQ:SECSTR cccEEETTccHHHHHHHcGGGHHHHTTTTcGGGGcHHHHTTHHHHccHHHHHHHHTccHHHHHHHHHHTTcEEEccc DISOP:02AL 1-1| PSIPRED cccEEccccHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccc //