[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55355.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  109/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.111.1b.1.18
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   30->216 2a96B PDBj 2e-13 13.6 %
:RPS:SCOP  117->210 1ayrA1  b.1.18.11 * 7e-12 9.6 %
:HMM:SCOP  1->212 1d2tA_ a.111.1.1 * 6.1e-34 32.7 %
:HMM:PFM   89->205 PF01569 * PAP2 2.8e-24 35.1 114/129  
:BLT:SWISS 64->132 YODM_BACSU 3e-07 41.5 %
:PROS 166->177|PS00962|RIBOSOMAL_S2_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55355.1 GT:GENE ACF55355.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 434647..435297 GB:FROM 434647 GB:TO 435297 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01569 GB:PROTEIN_ID ACF55355.1 GB:DB_XREF GI:194356907 LENGTH 216 SQ:AASEQ MRDKQTFLMKGSFALLLFVILGYMVKFYPETLVNFDQSIQTAIRGDLPDYLTILFRALTRLIDIPVIITWVVITAFVFYRKRWKIESFFMLGNLALAGLLIVTFKNIYQRPRPDILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKDPVWRKIVQIVLGLYLVSVLVSRVYLGVHYPSDVLASLCVGLGVLFIEFPXYDKLRFQWRFKGKQK GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 64->132|YODM_BACSU|3e-07|41.5|65/203| PROS 166->177|PS00962|RIBOSOMAL_S2_1|PDOC00744| TM:NTM 5 TM:REGION 7->29| TM:REGION 53->75| TM:REGION 85->107| TM:REGION 157->179| TM:REGION 181->203| SEG 161->178|vlglylvsvlvsrvylgv| RP:PDB:NREP 1 RP:PDB:REP 30->216|2a96B|2e-13|13.6|177/219| HM:PFM:NREP 1 HM:PFM:REP 89->205|PF01569|2.8e-24|35.1|114/129|PAP2| RP:SCP:NREP 1 RP:SCP:REP 117->210|1ayrA1|7e-12|9.6|94/182|b.1.18.11| HM:SCP:REP 1->212|1d2tA_|6.1e-34|32.7|202/224|a.111.1.1|1/1|Acid phosphatase/Vanadium-dependent haloperoxidase| OP:NHOMO 122 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------111-----------------------------------------------------------------------------------------------------------------------111111112121112------111-------222222-1-1111111111111121111222-----1111111---1111--1111111111111111111111111111111111111111111111------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 187 STR:RPRED 86.6 SQ:SECSTR #############################cHHHHHHHHHHHHHHTTTTcHHHHHHHHHTcccHHHHHHHHHHHHTcccTTTcHHHHHHHHHHHHHHHTTTTHHHHHHHccccHHGGHHHHTTccccccHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHT DISOP:02AL 1-3,214-217| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //