[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55356.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  19/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.128.1
:425 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   91->421 2gwdA PDBj 8e-11 24.8 %
:RPS:PDB   63->361 2d32B PDBj 2e-19 13.9 %
:RPS:SCOP  13->255 1r8gA  d.128.1.3 * 6e-06 16.9 %
:HMM:SCOP  13->421 1r8gA_ d.128.1.3 * 1.1e-42 25.5 %
:RPS:PFM   70->267 PF04107 * GCS2 2e-06 28.8 %
:HMM:PFM   79->210 PF04107 * GCS2 9.5e-06 17.6 125/290  
:HMM:PFM   349->393 PF08439 * Peptidase_M3_N 0.00012 29.5 44/70  
:BLT:SWISS 91->421 GSH1_BRAJU 2e-10 24.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55356.1 GT:GENE ACF55356.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1878487..1879764) GB:FROM 1878487 GB:TO 1879764 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55356.1 GB:DB_XREF GI:194356908 LENGTH 425 SQ:AASEQ MSCSIDLLKHRYLKNIKENPELFVGIELEYPVASLEGDATDVEVIKDLFHYLVSTLDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQLDISKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDEVIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAYLETAPFFKVFGYDYKSLRRQFSKKNLTDEEETTIIEFSKDLLLLAEEGLVVRNKEEMTYLQPLREELSL GT:EXON 1|1-425:0| BL:SWS:NREP 1 BL:SWS:REP 91->421|GSH1_BRAJU|2e-10|24.8|303/514| BL:PDB:NREP 1 BL:PDB:REP 91->421|2gwdA|8e-11|24.8|303/436| RP:PDB:NREP 1 RP:PDB:REP 63->361|2d32B|2e-19|13.9|280/499| RP:PFM:NREP 1 RP:PFM:REP 70->267|PF04107|2e-06|28.8|184/285|GCS2| HM:PFM:NREP 2 HM:PFM:REP 79->210|PF04107|9.5e-06|17.6|125/290|GCS2| HM:PFM:REP 349->393|PF08439|0.00012|29.5|44/70|Peptidase_M3_N| GO:PFM:NREP 2 GO:PFM GO:0004357|"GO:glutamate-cysteine ligase activity"|PF04107|IPR006336| GO:PFM GO:0006750|"GO:glutathione biosynthetic process"|PF04107|IPR006336| RP:SCP:NREP 1 RP:SCP:REP 13->255|1r8gA|6e-06|16.9|189/352|d.128.1.3| HM:SCP:REP 13->421|1r8gA_|1.1e-42|25.5|326/368|d.128.1.3|1/1|Glutamine synthetase/guanido kinase| OP:NHOMO 23 OP:NHOMOORG 21 OP:PATTERN ---------------------------------1---------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111----------------22-------------------------------------------1------------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 419 STR:RPRED 98.6 SQ:SECSTR ####ccccHHHHHHHHHHcGGGGEEEEEEEEEEcTTccTTcccccccccGGGccTcccccccEcTTcccccccccTTcccEEEcccTTEEEEEccccccHHHHHHHHHHHHHHHHTccTTcEEcccccccccccccTTHHcTTcccccccccccHHHHHHHHHHHHHHHHHccGccEEEEEEEccHHHHHHHHHHHHHHTTHHHHHHccccEcccccEEcTTccEEcTTcccGGGcTTcccccGGGcccccHHHHHHHHHHHHTcccHHHHHHcHHHHcEEcccEETTEEccccccccccGGGccccEEEEccccHHHcccEEEEEEEEccTTcTcHTcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHTTcTTcEccccEEHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHH## DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHcccEEEEEEEEccEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEcccEEEEEEEcccccEEEEEccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHHccccHHHHccccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHccEEEEEEcccEEEEccccccccccccccccccccccccccccccHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcc //