[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55365.1
DDBJ      :             cell wall surface anchor family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->99 PF06458 * MucBP 3e-08 52.5 %
:HMM:PFM   10->103 PF06458 * MucBP 7e-19 40.2 92/98  
:HMM:PFM   131->169 PF00746 * Gram_pos_anchor 6.6e-11 39.5 38/39  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55365.1 GT:GENE ACF55365.1 GT:PRODUCT cell wall surface anchor family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1370057..1370587) GB:FROM 1370057 GB:TO 1370587 GB:DIRECTION - GB:PRODUCT cell wall surface anchor family protein GB:NOTE identified by match to protein family HMM PF00746; match to protein family HMM PF06458; match to protein family HMM TIGR01167 GB:PROTEIN_ID ACF55365.1 GB:DB_XREF GI:194356917 LENGTH 176 SQ:AASEQ MVPKTATSTETKTITRIIHYVDKVTNQNVKEDVVQPVTLSRTKTENKVTGVVTYGEWTTGNWDEVVSGKIDKYKDPDIPTVESQEVTSDSSDKEITVRYDRLSTPDKPTPDPGTPKTETPVNPDPEVPTYETGKREELPNTGTEANATLASAGIMTLLAGLGLGFFKKKKMKNNRF GT:EXON 1|1-176:0| SEG 5->18|tatstetktitrii| SEG 104->120|tpdkptpdpgtpktetp| SEG 157->170|llaglglgffkkkk| RP:PFM:NREP 1 RP:PFM:REP 19->99|PF06458|3e-08|52.5|80/102|MucBP| HM:PFM:NREP 2 HM:PFM:REP 10->103|PF06458|7e-19|40.2|92/98|MucBP| HM:PFM:REP 131->169|PF00746|6.6e-11|39.5|38/39|Gram_pos_anchor| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,110-120,170-170,172-177| PSIPRED ccccccccccccEEEEEEEEEEccccccccccEEEEEEEEEEEEEEccccEEEcccccccEEccccccccccEEcccccccccEEcccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHcccccc //