[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55373.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.5
:106 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  9->88 1vgyA1  c.56.5.4 * 2e-04 26.2 %
:HMM:PFM   12->86 PF08702 * Fib_alpha 0.00016 14.9 74/146  
:BLT:SWISS 4->76 PLPA_MYCGA 4e-04 32.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55373.1 GT:GENE ACF55373.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(690196..690516) GB:FROM 690196 GB:TO 690516 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55373.1 GB:DB_XREF GI:194356925 LENGTH 106 SQ:AASEQ MRHKFQQVLDKIHDFLNGHDQPDQTETNSLTATIEEAIQKQTAVHLILSETSFTGDIIKYDQQGQQIIVKNFSKNVSRIIRISDIQRLRFVPSTVQTAQKNRFKKE GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 4->76|PLPA_MYCGA|4e-04|32.4|71/100| HM:PFM:NREP 1 HM:PFM:REP 12->86|PF08702|0.00016|14.9|74/146|Fib_alpha| RP:SCP:NREP 1 RP:SCP:REP 9->88|1vgyA1|2e-04|26.2|80/262|c.56.5.4| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111-------------111---1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,98-107| PSIPRED cHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEccHHHHHHHHHHHHHcc //